IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Vimentin expressed on Mycobacterium tuberculosis-infected human monocytes is involved in binding to the NKp46 receptor. Vimentin expressed on Mycobacterium tuberculosis-infected human monocytes is involved in binding to the NKp46 receptor. Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Garg A., Barnes PF., Porgador A., Roy S., Wu S., Nanda JS., Griffith DE., Girard WM., Rawal N., Shetty S., Vankayalapati R. if you do not like the Elisa/Far western due to lack of origin for VIm - maybe this whole publication should be deleted as there is no figure for the MS results? Krishna.vankayalapati@uthct.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Garg A., Barnes PF., Porgador A., Roy S., Wu S., Nanda JS., Griffith DE., Girard WM., Rawal N., Shetty S., Vankayalapati R. NKp46:Fc was determined to be of Human origin rather than Murine, as the supplier (R+D) specifically quotes this publication for the human chimera. Recombinant Vimentin has been assumed to be of Human origin: the protein cannot be traced on the supplier's web-site ( "Research Diagnostics") but all other traceable proteins are of human origin and other users cite the RD product to be of human origin. if you do not like the Elisa/Far western due to lack of origin for VIm - maybe this whole publication should be deleted as there is no figure for the MS results? Krishna.vankayalapati@uthct.edu Accepted 2017-JUN-08 AT 10:56 BST AT 10:56 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Vimentin expressed on Mycobacterium tuberculosis-infected human monocytes is involved in binding to the NKp46 receptor. Vimentin expressed on Mycobacterium tuberculosis-infected human monocytes is involved in binding to the NKp46 receptor. Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Garg A., Barnes PF., Porgador A., Roy S., Wu S., Nanda JS., Griffith DE., Girard WM., Rawal N., Shetty S., Vankayalapati R. if you do not like the Elisa/Far western due to lack of origin for VIm - maybe this whole publication should be deleted as there is no figure for the MS results? Krishna.vankayalapati@uthct.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Garg A., Barnes PF., Porgador A., Roy S., Wu S., Nanda JS., Griffith DE., Girard WM., Rawal N., Shetty S., Vankayalapati R. NKp46:Fc was determined to be of Human origin rather than Murine, as the supplier (R+D) specifically quotes this publication for the human chimera. Recombinant Vimentin has been assumed to be of Human origin: the protein cannot be traced on the supplier's web-site ( "Research Diagnostics") but all other traceable proteins are of human origin. if you do not like the Elisa/Far western due to lack of origin for VIm - maybe this whole publication should be deleted as there is no figure for the MS results? Krishna.vankayalapati@uthct.edu Accepted 2017-JUN-08 AT 10:56 BST AT 10:56 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Vimentin expressed on Mycobacterium tuberculosis-infected human monocytes is involved in binding to the NKp46 receptor. Vimentin expressed on Mycobacterium tuberculosis-infected human monocytes is involved in binding to the NKp46 receptor. Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Garg A., Barnes PF., Porgador A., Roy S., Wu S., Nanda JS., Griffith DE., Girard WM., Rawal N., Shetty S., Vankayalapati R. if you do not like the Elisa/Far western due to lack of origin for VIm - maybe this whole publication should be deleted as there is no figure for the MS results? Krishna.vankayalapati@uthct.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Garg A., Barnes PF., Porgador A., Roy S., Wu S., Nanda JS., Griffith DE., Girard WM., Rawal N., Shetty S., Vankayalapati R. if you do not like the Elisa/Far western due to lack of origin for VIm - maybe this whole publication should be deleted as there is no figure for the MS results? M. tuberculosis-infected monocytes obtained from blood. (CD14+) Krishna.vankayalapati@uthct.edu Accepted 2017-JUN-08 AT 10:56 BST AT 10:56 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE DIP protein P08670 original sequence version: 195 DIP protein P08670 original sequence version: 209 DIP protein P08670 original sequence version: 192 DIP protein P08670 original sequence version: 175 BAB54026665B015A nctr1_human Natural cytotoxicity triggering receptor 1 NCR1 LY94 Lymphocyte antigen 94 homolog NK cell-activating receptor Natural killer cell p46-related protein protein protein human Homo sapiens Human MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL FBCBDE50D2F34CD3 ncr1-vim-1 3 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association none (text below figure 1) ncr1-vim-2 1 5 unspecified role unspecified role prey prey c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind range range range range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 4 unspecified role unspecified role bait bait direct interaction direct interaction Figure 6 p46 ecd region has been entered in fuzzy type as supplier's site only has a prediction for N-term residue, and this protein is stated to be Isoform-6 which is missing ONE amino acid (228) as compared to canonical. vim-ncr1-1 2 5 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind range range range range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 4 unspecified role unspecified role prey prey direct interaction direct interaction Figure 6B p46 ecd region has been entered in fuzzy type as supplier's site only has a prediction for N-term residue, and this protein is stated to be Isoform-6 which is missing ONE amino acid (228) as compared to canonical. Immunoprecipitation, followed by mass spectrometry analysis, identified vimentin as a putative ligand for NKp46.