DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu erbB2 is required for G protein-coupled receptor signaling in the heart. erbB2 is required for G protein-coupled receptor signaling in the heart. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Negro A., Brar BK., Gu Y., Peterson KL., Vale W., Lee KF. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Negro A., Brar BK., Gu Y., Peterson KL., Vale W., Lee KF. DIP original experiment: DIP-263998X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx erbB2 is required for G protein-coupled receptor signaling in the heart. erbB2 is required for G protein-coupled receptor signaling in the heart. erbB2 is required for G protein-coupled receptor signaling in the heart. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Negro A., Brar BK., Gu Y., Peterson KL., Vale W., Lee KF. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Negro A., Brar BK., Gu Y., Peterson KL., Vale W., Lee KF. DIP original experiment: DIP-263996X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx erbB2 is required for G protein-coupled receptor signaling in the heart. erbB2 is required for G protein-coupled receptor signaling in the heart. erbB2 is required for G protein-coupled receptor signaling in the heart. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Negro A., Brar BK., Gu Y., Peterson KL., Vale W., Lee KF. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Negro A., Brar BK., Gu Y., Peterson KL., Vale W., Lee KF. DIP original experiment: DIP-263995X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx erbB2 is required for G protein-coupled receptor signaling in the heart. erbB2 is required for G protein-coupled receptor signaling in the heart. erbB2 is required for G protein-coupled receptor signaling in the heart. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Negro A., Brar BK., Gu Y., Peterson KL., Vale W., Lee KF. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Negro A., Brar BK., Gu Y., Peterson KL., Vale W., Lee KF. DIP original experiment: DIP-263997X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx erbB2 is required for G protein-coupled receptor signaling in the heart. erbb2_mouse Receptor tyrosine-protein kinase erbB-2 Erbb2 Kiaa3023 Neu Proto-oncogene Neu Proto-oncogene c-ErbB-2 p185erbB2 protein protein mouse Mus musculus Mouse MELAAWCRWGFLLALLSPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPANASLSFLQDIQEVQGYMLIAHNRVKHVPLQRLRIVRGTQLFEDKYALAVLDNRDPLDNVTTAAPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVLRKNNQLAPVDMDTNRSRACPPCAPTCKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALITYNTDTFESMLNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKCSKPCAGVCYGLGMEHLRGARAITSDNIQEFAGCKKIFGSLAFLPESFDGNPSSGVAPLKPEHLQVFETLEEITGYLYISAWPESFQDLSVFQNLRVIRGRILHDGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFVNTVPWDQLFRNPHQALLHSGNRPEEACGLEGLVCNSLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVWKGLPREYVRGKHCLPCHPECQPQNSSETCYGSEADQCEACAHYKDSSSCVARCPSGVKPDLSYMPIWKYPDEEGICQPCPINCTHSCVDLDERGCPAEQRASPVTFIIATVVGVLLFLIIVVVIGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAVPNQAQMRILKETELRKLKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEEVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPSSPMDSTFYRSLLEDDDMGELVDAEEYLVPQQGFFSPDPALGTGSTAHRRHRSSSARSGGGELTLGLEPSEEEPPRSPLAPSEGAGSDVFDGDLAVGVTKGLQSLSPHDLSPLQRYSEDPTLPLPPETDGYVAPLACSPQPEYVNQPEVRPQSPLTPEGPPPPIRPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPRAGTASQPHPSPAFSPAFDNLYYWDQNSSEQGPPPSTFEGTPTAENPEYLGLDVPV DIP protein P70424 original sequence version: 159 6040978428B93A28 adrb2_mouse Beta-2 adrenergic receptor Beta-2 adrenoreceptor Adrb2 Adrb2r protein protein mouse Mus musculus Mouse MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAKFERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKKAIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRDNLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNGRTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTVPSLSVDSQGRNCSTNDSPL DIP protein P18762 original sequence version: 145 DIP protein P18762 original sequence version: 147 This sequence has been withdrawn from Uniprot. 51D1EC73D7619D58 crfr2_mouse Corticotropin-releasing factor receptor 2 CRF-RB Corticotropin-releasing hormone receptor 2 Crhr2 Crf2r protein protein mouse Mus musculus Mouse MDAALLLSLLEANCSLALAEELLLDGWGVPPDPEGPYTYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV DIP protein Q60748 original sequence version: 124 crhr2-erbb2-1 3 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 5 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association erbb2-adrb2-1 1 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse 5 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association adrb2-erbb2-1 2 6 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 5 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association adrb2-erbb2-2 4 6 unspecified role unspecified role bait bait mouse Mus musculus Mouse 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association