DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structures of frataxin oligomers reveal the mechanism for the delivery and detoxification of iron. The structures of frataxin oligomers reveal the mechanism for the delivery and detoxification of iron. Structure (London, England : 1993) 2006 imex curation Karlberg T., Schagerlöf U., Gakh O., Park S., Ryde U., Lindahl M., Leath K., Garman E., Isaya G., Al-Karadaghi S. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Karlberg T., Schagerlöf U., Gakh O., Park S., Ryde U., Lindahl M., Leath K., Garman E., Isaya G., Al-Karadaghi S. DIP original experiment: DIP-66380X Structure (London, England : 1993) 2006 IMEx The structures of frataxin oligomers reveal the mechanism for the delivery and detoxification of iron. The structures of frataxin oligomers reveal the mechanism for the delivery and detoxification of iron. The structures of frataxin oligomers reveal the mechanism for the delivery and detoxification of iron. Structure (London, England : 1993) 2006 imex curation Karlberg T., Schagerlöf U., Gakh O., Park S., Ryde U., Lindahl M., Leath K., Garman E., Isaya G., Al-Karadaghi S. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Karlberg T., Schagerlöf U., Gakh O., Park S., Ryde U., Lindahl M., Leath K., Garman E., Isaya G., Al-Karadaghi S. DIP original experiment: DIP-66379X Structure (London, England : 1993) 2006 IMEx The structures of frataxin oligomers reveal the mechanism for the delivery and detoxification of iron. frda_yeast Frataxin homolog, mitochondrial YFH1 YDL120W protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKRSLASLVRVSSVMGRRYMIAAAGGERARFCPAVTNKKNHTVNTFQKRFVESSTDGQVVPQEVLNLPLEKYHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ AB1FF7478EF0E5D6 AB1FF7478EF0E5D6 frataxin-1 2 3 unspecified role unspecified role unspecified role unspecified role Region 52-174 Region 52-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q07540:p.Tyr73Ala Y73A mutation mutation certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y73A'. Wed May 02 17:06:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr73ala' Tue Jun 30 17:06:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr73Ala' ecolx Escherichia coli physical association physical association frataxin-2 1 3 unspecified role unspecified role unspecified role unspecified role Region 52-174 Region 52-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q07540:p.Tyr73Ala Y73A mutation mutation certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y73A'. Wed May 02 16:17:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr73ala' Tue Jun 30 18:38:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr73Ala' ecolx Escherichia coli direct interaction direct interaction