DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Sitar T., Popowicz GM., Siwanowicz I., Huber R., Holak TA. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Sitar T., Popowicz GM., Siwanowicz I., Huber R., Holak TA. DIP original experiment: DIP-263764X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Sitar T., Popowicz GM., Siwanowicz I., Huber R., Holak TA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sitar T., Popowicz GM., Siwanowicz I., Huber R., Holak TA. DIP original experiment: DIP-263763X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Sitar T., Popowicz GM., Siwanowicz I., Huber R., Holak TA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sitar T., Popowicz GM., Siwanowicz I., Huber R., Holak TA. DIP original experiment: DIP-263762X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Sitar T., Popowicz GM., Siwanowicz I., Huber R., Holak TA. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sitar T., Popowicz GM., Siwanowicz I., Huber R., Holak TA. DIP original experiment: DIP-263765X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. ibp4_human Insulin-like growth factor-binding protein 4 IGFBP4 IBP4 protein protein human Homo sapiens Human MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE DIP protein P22692 original sequence version: 113 DIP protein P22692-1 original sequence version: 153 DIP protein P22692 original sequence version: 145 5E8F4638D99F0A94 igf1_human Insulin-like growth factor I IGF1 IBP1 Somatomedin-C Mechano growth factor protein protein human Homo sapiens Human MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK DIP protein P05019 original sequence version: 130 DIP protein P05019 original sequence version: 178 DIP protein P05019 original sequence version: 140 DIP protein P05019 original sequence version: 186 DIP protein P05019 original sequence version: 151 The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation mint E88A8CFBD1CD1873 ibp1_human Insulin-like growth factor-binding protein 1 IGFBP1 IBP1 Placental protein 12 protein protein human Homo sapiens Human MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN DIP protein P08833 original sequence version: 172 DIP protein P08833 original sequence version: 147 8AA75AF7DC966012 igf1-igfbp4-5 3 6 unspecified role unspecified role unspecified role unspecified role Region 49-118 Region 49-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 22-113 Region 22-113 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction igf1-igfbp4-6 1 6 unspecified role unspecified role unspecified role unspecified role Region 49-118 Region 49-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 22-113 Region 22-113 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction igf1-igfbp1-1 2 6 unspecified role unspecified role unspecified role unspecified role Region 49-118 Region 49-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 166-259 Region 166-259 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 22-113 Region 22-113 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction igf1-igfbp4-7 4 6 unspecified role unspecified role unspecified role unspecified role Region 49-118 Region 49-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 22-113 Region 22-113 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction