DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263733X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263731X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263743X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263741X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263737X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263734X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263740X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263735X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263736X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263738X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263732X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263742X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263739X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. tfap4_human Transcription factor AP-4 TFAP4 Activating enhancer-binding protein 4 BHLHC41 Class C basic helix-loop-helix protein 41 protein protein human Homo sapiens Human MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP DIP protein Q01664 original sequence version: 141 540C008658596B83 q9jiz5_mouse Tfap4 Ap4 Tcfap4 protein protein mouse Mus musculus Mouse MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPTHHPTVIVPAPAPPSSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQDKQELEEEQRRAVIVKSVRSCPDAHTSDTASDSEASDSDAMDQSREEPLGDGELP DIP protein Q9JIZ5 original sequence version: 110 DIP protein Q9JIZ5 original sequence version: 90 sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q60520 original sequence version: 144 DIP protein Q60520 original sequence version: 106 DIP protein Q60520 original sequence version: 115 DIP protein Q60520 original sequence version: 158 80FE378F62ED7CB3 hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 ncor2_human Nuclear receptor corepressor 2 NCOR2 CTG26 Silencing mediator of retinoic acid and thyroid hormone receptor Thyroid-, retinoic-acid-receptor-associated corepressor T3 receptor-associating factor CTG repeat protein 26 SMAP270 protein protein human Homo sapiens Human MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQSAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEEAEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPPGPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEGEEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGSGRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKPLDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPRGKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPPGHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEHAKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTALGSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGREDSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRAISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELPLAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALERACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSGVDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDRDRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPISPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRPLVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGYHGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHLPHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIEPVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLEAIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE DIP protein Q9Y618 original sequence version: 166 DIP protein Q9Y618-1 original sequence version: 119 DIP protein Q9Y618-1 original sequence version: 155 DIP protein Q9Y618 original sequence version: 134 DIP protein Q9Y618 original sequence version: 138 70A89C9A19612AAD gem_human GTP-binding protein GEM GTP-binding mitogen-induced T-cell protein RAS-like protein KIR GEM KIR protein protein human Homo sapiens Human MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL DIP protein P55040 original sequence version: 149 DIP protein P55040 original sequence version: 112 B7BB3F2CA96D338F gemi_mouse Geminin Gmnn protein protein mouse Mus musculus Mouse MNLSMKQKQEGAQENVKNSPVPRRTLKMIQPSADGSLVGRENELPKGLFKRKLWDDQLASQTSSCGPEANENKDVGDLTQEAFDLISKENPSSQYWKEVAEQRRKALYEALKENEKLHKEIEQKDSEIARLRKENKDLAEVAEHVQYMAEVIERLSNEPLDNFESPDSQEFDSEEEAVEYSELEDSGAGTCAEETVSSSTDARPCT DIP protein O88513 original sequence version: 112 DIP protein O88513 original sequence version: 104 B87153A5D5BCF5CF ncor1_mouse Nuclear receptor corepressor 1 Ncor1 Rxrip13 Retinoid X receptor-interacting protein 13 protein protein mouse Mus musculus Mouse MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD DIP protein Q60974 original sequence version: 149 DIP protein Q60974 original sequence version: 144 DIP protein Q60974 original sequence version: 110 DIP protein Q60974 original sequence version: 92 DIP protein Q60974-1 original sequence version: 110 DIP protein Q60974 original sequence version: 161 DIP protein Q60974 original sequence version: 131 52208B40382F7E6A tfap4-gem-1 2 19 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association ncor2-tfap4-1 7 15 unspecified role unspecified role prey prey in vitro In vitro 18 unspecified role unspecified role bait bait Region 1059-1495 Region 1059-1495 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro direct interaction direct interaction hdac3-gem-1 9 19 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait human Homo sapiens Human association association gem-tfap4-1 11 14 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association sin3a-tfap4-1 4 16 unspecified role unspecified role bait bait Region 1-479 Region 1-479 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 15 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction tfap4-gmnn-1 1 20 unspecified role unspecified role prey prey in vitro In vitro 15 unspecified role unspecified role bait bait Region 99-186 Region 99-186 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro direct interaction direct interaction ncor2-gem-1 5 19 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association ncor1-tfap4-1 12 21 unspecified role unspecified role bait bait Region 1986-2443 Region 1986-2443 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 15 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction tfap4-gmnn-2 6 20 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 95-209 Region 95-209 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 15 unspecified role unspecified role bait bait Region 99-186 Region 99-186 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro direct interaction direct interaction gmnn-ncor2-1 10 18 unspecified role unspecified role prey prey Region 1059-1495 Region 1059-1495 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ncor2-gmnn-1 3 18 unspecified role unspecified role bait bait in vitro In vitro 20 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction ncor2-gmnn-2 13 18 unspecified role unspecified role bait bait Region 1059-1495 Region 1059-1495 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 20 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction tfap4-gem-2 8 19 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait Region 99-186 Region 99-186 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association