DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The crystal structure of the costimulatory OX40-OX40L complex. The crystal structure of the costimulatory OX40-OX40L complex. Structure (London, England : 1993) 2006 imex curation Compaan DM., Hymowitz SG. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66339X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. The crystal structure of the costimulatory OX40-OX40L complex. The crystal structure of the costimulatory OX40-OX40L complex. Structure (London, England : 1993) 2006 imex curation Compaan DM., Hymowitz SG. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66340X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. The crystal structure of the costimulatory OX40-OX40L complex. The crystal structure of the costimulatory OX40-OX40L complex. Structure (London, England : 1993) 2006 imex curation Compaan DM., Hymowitz SG. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66337X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. The crystal structure of the costimulatory OX40-OX40L complex. The crystal structure of the costimulatory OX40-OX40L complex. Structure (London, England : 1993) 2006 imex curation Compaan DM., Hymowitz SG. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66338X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. The crystal structure of the costimulatory OX40-OX40L complex. The crystal structure of the costimulatory OX40-OX40L complex. Structure (London, England : 1993) 2006 imex curation Compaan DM., Hymowitz SG. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66336X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. tnr4_human Tumor necrosis factor receptor superfamily member 4 ACT35 antigen OX40L receptor TAX transcriptionally-activated glycoprotein 1 receptor TNFRSF4 TXGP1L protein protein human Homo sapiens Human MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI DIP protein P43489 original sequence version: 59 tnfl4_human Tumor necrosis factor ligand superfamily member 4 TNFSF4 TXGP1 Glycoprotein Gp34 OX40 ligand TAX transcriptionally-activated glycoprotein 1 protein protein human Homo sapiens Human MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL DIP protein P23510 original sequence version: 52 tnfl4_mouse Tumor necrosis factor ligand superfamily member 4 OX40 ligand Tnfsf4 Ox40l Txgp1l protein protein mouse Mus musculus Mouse MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL DIP protein P43488 original sequence version: 42 F4B23A7CC0590459 tnfrsf4-tnfsf4-1 2 6 unspecified role unspecified role unspecified role unspecified role Binding region 51-183 Binding region 51-183 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 7 unspecified role unspecified role unspecified role unspecified role Binding region 29-170 Binding region 29-170 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction tnfsf4-1 5 8 unspecified role unspecified role unspecified role unspecified role Region 51-198 Region 51-198 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction tnfsf4-tnfsf4-1 3 7 unspecified role unspecified role unspecified role unspecified role Binding region 29-170 Binding region 29-170 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role unspecified role unspecified role Binding region 51-198 Binding region 51-198 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction tnfsf4-tnfsf4-2 1 7 unspecified role unspecified role unspecified role unspecified role Binding region 29-170 Binding region 29-170 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role unspecified role unspecified role Binding region 51-198 Binding region 51-198 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction tnfrsf4-tnfsf4-2 4 6 unspecified role unspecified role unspecified role unspecified role Binding region 51-183 Binding region 51-183 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 7 unspecified role unspecified role unspecified role unspecified role Binding region 29-170 Binding region 29-170 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction