DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zhao JM., Lee H., Nome RA., Majid S., Scherer NF., Hoff WD. Only protein-protein interactions in vitro In vitro atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Zhao JM., Lee H., Nome RA., Majid S., Scherer NF., Hoff WD. DIP original experiment: DIP-263432X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zhao JM., Lee H., Nome RA., Majid S., Scherer NF., Hoff WD. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Zhao JM., Lee H., Nome RA., Majid S., Scherer NF., Hoff WD. DIP original experiment: DIP-263431X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zhao JM., Lee H., Nome RA., Majid S., Scherer NF., Hoff WD. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Zhao JM., Lee H., Nome RA., Majid S., Scherer NF., Hoff WD. DIP original experiment: DIP-263433X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zhao JM., Lee H., Nome RA., Majid S., Scherer NF., Hoff WD. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao JM., Lee H., Nome RA., Majid S., Scherer NF., Hoff WD. DIP original experiment: DIP-263430X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Single-molecule detection of structural changes during Per-Arnt-Sim (PAS) domain activation. pyp_halha Photoactive yellow protein pyp protein protein halha Halorhodospira halophila Ectothiorhodospira halophila MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV DIP protein P16113 original sequence version: 98 pyp-1 4 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pyp-2 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pyp-3 1 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pyp-4 3 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction