DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Regulation of intracellular free calcium concentration during heterocyst differentiation by HetR and NtcA in Anabaena sp. PCC 7120. Regulation of intracellular free calcium concentration during heterocyst differentiation by HetR and NtcA in Anabaena sp. PCC 7120. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shi Y., Zhao W., Zhang W., Ye Z., Zhao J. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Shi Y., Zhao W., Zhang W., Ye Z., Zhao J. DIP original experiment: DIP-263427X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Regulation of intracellular free calcium concentration during heterocyst differentiation by HetR and NtcA in Anabaena sp. PCC 7120. Regulation of intracellular free calcium concentration during heterocyst differentiation by HetR and NtcA in Anabaena sp. PCC 7120. Regulation of intracellular free calcium concentration during heterocyst differentiation by HetR and NtcA in Anabaena sp. PCC 7120. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shi Y., Zhao W., Zhang W., Ye Z., Zhao J. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Shi Y., Zhao W., Zhang W., Ye Z., Zhao J. DIP original experiment: DIP-263428X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Regulation of intracellular free calcium concentration during heterocyst differentiation by HetR and NtcA in Anabaena sp. PCC 7120. Regulation of intracellular free calcium concentration during heterocyst differentiation by HetR and NtcA in Anabaena sp. PCC 7120. Regulation of intracellular free calcium concentration during heterocyst differentiation by HetR and NtcA in Anabaena sp. PCC 7120. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shi Y., Zhao W., Zhang W., Ye Z., Zhao J. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Shi Y., Zhao W., Zhang W., Ye Z., Zhao J. DIP original experiment: DIP-263429X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Regulation of intracellular free calcium concentration during heterocyst differentiation by HetR and NtcA in Anabaena sp. PCC 7120. q8yy42_noss1 ccbP alr1010 protein protein noss1 Nostoc sp. (strain PCC 7120 / UTEX 2576) MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF DIP protein Q8YY42 original sequence version: 65 hetr_noss1 DNA-binding transcriptional activator HetR hetR Heterocyst differentiation control protein alr2339 protein protein noss1 Nostoc sp. (strain PCC 7120 / UTEX 2576) MSNDIDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKIIVEEVRQALMEGKLLKTLGSQEPRYLIQFPYVWMEQYPWIPGRSRIPGTSLTSEEKRQIEHKLPSNLPDAQLVTSFEFLELIEFLHKRSQEDLPPEHRMELSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARYFRMMKDWAEKRPNAMRALEELDVPPERWDEAMQELDEIIRTWADKYHQVGGIPMILQMVFGRKED DIP protein P27709 original sequence version: 81 ccbp-hetr-1 1 4 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 5 enzyme enzyme unspecified role unspecified role P27709:p.Ser152Ala S152A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S152A'. Wed May 02 16:00:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser152ala' Tue Jun 30 18:25:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser152Ala' P27709:p.Ser179Asn S179N mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S N This feature has been corrected as a result of our quality control procedures. The original label was 'S179N'. Wed May 02 14:56:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser179asn' Tue Jun 30 18:30:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser179Asn' ecolx Escherichia coli protein cleavage protein cleavage hetr-1 2 5 putative self putative self unspecified role unspecified role P27709:p.Ser152Ala S152A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S152A'. Wed May 02 17:01:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser152ala' Tue Jun 30 17:28:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser152Ala' P27709:p.Ser179Asn S179N mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S N This feature has been corrected as a result of our quality control procedures. The original label was 'S179N'. Wed May 02 17:06:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser179asn' Tue Jun 30 17:57:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser179Asn' ecolx Escherichia coli protein cleavage protein cleavage true hetr-2 3 5 putative self putative self unspecified role unspecified role P27709:p.Ser152Ala S152A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S152A'. Wed May 02 17:38:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser152ala' Tue Jun 30 18:44:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser152Ala' P27709:p.Ser179Asn S179N mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S N This feature has been corrected as a result of our quality control procedures. The original label was 'S179N'. Wed May 02 15:32:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser179asn' Tue Jun 30 15:52:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser179Asn' ecolx Escherichia coli direct interaction direct interaction true