DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. Nature structural & molecular biology 2006 imex curation Barton WA., Tzvetkova-Robev D., Miranda EP., Kolev MV., Rajashankar KR., Himanen JP., Nikolov DB. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Barton WA., Tzvetkova-Robev D., Miranda EP., Kolev MV., Rajashankar KR., Himanen JP., Nikolov DB. DIP original experiment: DIP-66230X Nature structural & molecular biology 2006 IMEx Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. Nature structural & molecular biology 2006 imex curation Barton WA., Tzvetkova-Robev D., Miranda EP., Kolev MV., Rajashankar KR., Himanen JP., Nikolov DB. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Barton WA., Tzvetkova-Robev D., Miranda EP., Kolev MV., Rajashankar KR., Himanen JP., Nikolov DB. DIP original experiment: DIP-66229X Nature structural & molecular biology 2006 IMEx Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. Nature structural & molecular biology 2006 imex curation Barton WA., Tzvetkova-Robev D., Miranda EP., Kolev MV., Rajashankar KR., Himanen JP., Nikolov DB. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Barton WA., Tzvetkova-Robev D., Miranda EP., Kolev MV., Rajashankar KR., Himanen JP., Nikolov DB. DIP original experiment: DIP-66228X Nature structural & molecular biology 2006 IMEx Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. tie2_human Angiopoietin-1 receptor TEK TIE2 Tyrosine-protein kinase receptor TIE-2 Tyrosine-protein kinase receptor TEK Tunica interna endothelial cell kinase p140 TEK Endothelial tyrosine kinase Tyrosine kinase with Ig and EGF homology domains-2 VMCM VMCM1 protein protein human Homo sapiens Human MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA DIP protein Q02763 original sequence version: 123 DIP protein Q02763 original sequence version: 79 E739DEC3E4FEB124 o15123-1 Angiopoietin-2 ANGPT2 protein protein human Homo sapiens Human MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF DIP protein O15123-1 original sequence version: 87 DIP protein O15123 original sequence version: 50 angp1_mouse Angiopoietin-1 Angpt1 Agpt protein protein mouse Mus musculus Mouse MTVFLSFAFFAAILTHIGCSNQRRNPENGGRRYNRIQHGQCAYTFILPEHDGNCRESATEQYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVSRQTFIIQELEKQLSRATNNNSILQKQQLELMDTVHNLISLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF DIP protein O08538 original sequence version: 1(def) angpt1-tek-1 1 6 unspecified role unspecified role neutral component neutral component 279-498 binding region 279-498 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 4 unspecified role unspecified role neutral component neutral component 23-452 binding region 23-452 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction angpt2-tek-4 3 5 unspecified role unspecified role neutral component neutral component 276-496 binding region 276-496 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 4 unspecified role unspecified role neutral component neutral component 23-452 binding region 23-452 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction angpt2-tek-5 2 5 unspecified role unspecified role neutral component neutral component 276-496 binding region 276-496 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 4 unspecified role unspecified role neutral component neutral component 23-452 binding region 23-452 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction