DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. DIP original experiment: DIP-262911X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. DIP original experiment: DIP-262912X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. DIP original experiment: DIP-262913X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. DIP original experiment: DIP-262914X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. q15369-1 Elongin-C ELOC TCEB1 Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC DIP protein Q15369-1 original sequence version: 143 DIP protein Q15369 original sequence version: 66 DIP protein Q15369-1 original sequence version: 133 DIP protein Q15369-1 original sequence version: 146 q15370-1 Elongin-B ELOB TCEB2 Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ DIP protein Q15370-1 original sequence version: 150 DIP protein Q15370 original sequence version: 72 DIP protein Q15370 original sequence version: 134 DIP protein Q15370 original sequence version: 140 DIP protein Q15370 original sequence version: 156 DIP protein Q15370 original sequence version: 152 ghr peptide GHR peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PVPDYTSIHIV socs2_human Suppressor of cytokine signaling 2 Cytokine-inducible SH2 protein 2 STAT-induced STAT inhibitor 2 CIS2 SSI2 STATI2 SOCS2 protein protein human Homo sapiens Human MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV DIP protein O14508 original sequence version: 133 DIP protein O14508 original sequence version: 61 DAFC4AD97F8182BF epor peptide EpoR peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ASFEYTILDPS elob-eloc-1 1 5 unspecified role unspecified role unspecified role unspecified role Region 17-112 Region 17-112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 32-198 Region 32-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association ghr peptide-socs2-1 3 7 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction epor peptide-socs2-1 4 9 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction elob-eloc-2 2 5 unspecified role unspecified role unspecified role unspecified role Region 17-112 Region 17-112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 32-198 Region 32-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction