DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. PLoS biology 2006 imex curation Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. DIP original experiment: DIP-66453X PLoS biology 2006 IMEx Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. PLoS biology 2006 imex curation Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. DIP original experiment: DIP-66452X PLoS biology 2006 IMEx Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. PLoS biology 2006 imex curation Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. DIP original experiment: DIP-66451X PLoS biology 2006 IMEx Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. ercc3_human General transcription and DNA repair factor IIH helicase subunit XPB ERCC3 XPB XPBC Basic transcription factor 2 89 kDa subunit TFIIH basal transcription factor complex 89 kDa subunit DNA repair protein complementing XP-B cells Xeroderma pigmentosum group B-complementing protein DNA excision repair protein ERCC-3 protein protein human Homo sapiens Human MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK DIP protein P19447 original sequence version: 86 DIP protein P19447 original sequence version: 127 DIP protein P19447 original sequence version: 126 DIP protein P19447 original sequence version: 191 DIP protein P19447 original sequence version: 182 F5F4D3A89A7DF826 ercc2_human General transcription and DNA repair factor IIH helicase subunit XPD ERCC2 XPD XPDC Basic transcription factor 2 80 kDa subunit CXPD DNA excision repair protein ERCC-2 DNA repair protein complementing XP-D cells TFIIH basal transcription factor complex 80 kDa subunit Xeroderma pigmentosum group D-complementing protein protein protein human Homo sapiens Human MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL DIP protein P18074 original sequence version: 90 DIP protein P18074 original sequence version: 132 DIP protein P18074 original sequence version: 198 746C0888CDF2E331 tf2h2_human General transcription factor IIH subunit 2 General transcription factor IIH polypeptide 2 TFIIH basal transcription factor complex p44 subunit Basic transcription factor 2 44 kDa subunit GTF2H2 BTF2P44 protein protein human Homo sapiens Human MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV DIP protein Q13888 original sequence version: 66 DIP protein Q13888 original sequence version: 109 DIP protein Q13888 original sequence version: 173 56D1BD8841288739 tf2h5_human General transcription factor IIH subunit 5 TFIIH subunit p8 GTF2H5 C6orf175 TTDA General transcription factor IIH polypeptide 5 TFB5 ortholog TFIIH basal transcription factor complex TTD-A subunit protein protein human Homo sapiens Human MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK DIP protein Q6ZYL4 original sequence version: 27 DIP protein Q6ZYL4 original sequence version: 65 DIP protein Q6ZYL4 original sequence version: 121 DBEB4D3C9BFA2C54 gtf2h5-ercc3-1 3 4 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human direct interaction direct interaction gtf2h2-gtf2h5-1 2 6 unspecified role unspecified role bait bait human Homo sapiens Human 7 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human direct interaction direct interaction ercc2-ercc3-1 1 5 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 4 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction