DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Reconstruction of the chemotaxis receptor-kinase assembly. Reconstruction of the chemotaxis receptor-kinase assembly. Nature structural & molecular biology 2006 imex curation Park SY., Borbat PP., Gonzalez-Bonet G., Bhatnagar J., Pollard AM., Freed JH., Bilwes AM., Crane BR. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Park SY., Borbat PP., Gonzalez-Bonet G., Bhatnagar J., Pollard AM., Freed JH., Bilwes AM., Crane BR. DIP original experiment: DIP-66225X Nature structural & molecular biology 2006 IMEx Reconstruction of the chemotaxis receptor-kinase assembly. Reconstruction of the chemotaxis receptor-kinase assembly. Reconstruction of the chemotaxis receptor-kinase assembly. Nature structural & molecular biology 2006 imex curation Park SY., Borbat PP., Gonzalez-Bonet G., Bhatnagar J., Pollard AM., Freed JH., Bilwes AM., Crane BR. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Park SY., Borbat PP., Gonzalez-Bonet G., Bhatnagar J., Pollard AM., Freed JH., Bilwes AM., Crane BR. DIP original experiment: DIP-66224X Nature structural & molecular biology 2006 IMEx Reconstruction of the chemotaxis receptor-kinase assembly. Reconstruction of the chemotaxis receptor-kinase assembly. Reconstruction of the chemotaxis receptor-kinase assembly. Nature structural & molecular biology 2006 imex curation Park SY., Borbat PP., Gonzalez-Bonet G., Bhatnagar J., Pollard AM., Freed JH., Bilwes AM., Crane BR. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Park SY., Borbat PP., Gonzalez-Bonet G., Bhatnagar J., Pollard AM., Freed JH., Bilwes AM., Crane BR. DIP original experiment: DIP-66226X Nature structural & molecular biology 2006 IMEx Reconstruction of the chemotaxis receptor-kinase assembly. Reconstruction of the chemotaxis receptor-kinase assembly. Reconstruction of the chemotaxis receptor-kinase assembly. Nature structural & molecular biology 2006 imex curation Park SY., Borbat PP., Gonzalez-Bonet G., Bhatnagar J., Pollard AM., Freed JH., Bilwes AM., Crane BR. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Park SY., Borbat PP., Gonzalez-Bonet G., Bhatnagar J., Pollard AM., Freed JH., Bilwes AM., Crane BR. DIP original experiment: DIP-66223X Nature structural & molecular biology 2006 IMEx Reconstruction of the chemotaxis receptor-kinase assembly. mcp2_thema Methyl-accepting chemotaxis protein 2 mcp2 TM_1143 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MSLKGKTLLVSTITLAAVVLVALLGGSVFLKAGQNVRKAFEEYELAVEALDKLGELETKVALFVNNAAKIEEVSSLFNELKKVADKIPSLKEHMDALERNISEIISGKTEVVSRIQSSVDQVKEDIMANLDRTRENLDKEISYSSELIRNVLFIVLPIVAVASGVFLFVMISRSLRLLKPVMEASRSLRNNDLTINIQEAKGKDEISTLLNEFKASIEYLRNNLKDVQTETFSVAESIEEISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIADSAQQAASFADQSTQLAKEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTNLLALNAAIEAARAGEAGRGFAVVADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAVERINEMLQNIAAAIEEQTAAVDEITTAMTENAKNAEEITNSVKEVNARLQEISASTEEVTSRVQTIRENVQMLKEIVARYKI C04149A4F46890CE chew_thema Chemotaxis protein CheW cheW TM_0701 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MKTLADALKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITVKEGV 122A5EFEDFA3D561 chea_thema Chemotaxis protein CheA cheA TM_0702 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MMEEYLGVFVDETKEYLQNLNDTLLELEKNPEDMELINEAFRALHTLKGMAGTMGFSSMAKLCHTLENILDKARNSEIKITSDLLDKIFAGVDMITRMVDKIVSEGSDDIGENIDVFSDTIKSFASSGKEKPSEIKNETETKGEEEHKGESTSNEEVVVLPEEVAHVLQEARNKGFKTFYIKVILKEGTQLKSARIYLVFHKLEELKCEVVRTIPSVEEIEEEKFENEVELFVISPVDLEKLSEALSSIADIERVIIKEVTAVTEESGAEKRTEKEEKTEKTEEKAERKKVISQTVRVDIEKLDNLMDLMGELVIARSRILETLKKYNIKELDESLSHLSRITLDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTLAIIQALLVKVNNLVYAIPIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQDDIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV F264398B88DA34E1 F264398B88DA34E1 chea-chew-2 2 7 unspecified role unspecified role neutral component neutral component 540-671 binding region P5 540-671 binding region P5 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction chea-chew-3 1 6 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 7 unspecified role unspecified role neutral component neutral component 355-671 binding region P5 355-671 binding region P5 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mcp1143-1 4 5 unspecified role unspecified role neutral component neutral component 225-530 binding region 225-530 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chea-1 3 7 unspecified role unspecified role neutral component neutral component 290-671 binding region P345 290-671 binding region P345 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction