DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. Structure (London, England : 1993) 2006 imex curation Huang Y., Myers MP., Xu RM. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Huang Y., Myers MP., Xu RM. DIP original experiment: DIP-66283X Structure (London, England : 1993) 2006 IMEx Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. Structure (London, England : 1993) 2006 imex curation Huang Y., Myers MP., Xu RM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Huang Y., Myers MP., Xu RM. DIP original experiment: DIP-66282X Structure (London, England : 1993) 2006 IMEx Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. Structure (London, England : 1993) 2006 imex curation Huang Y., Myers MP., Xu RM. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Huang Y., Myers MP., Xu RM. DIP original experiment: DIP-66281X Structure (London, England : 1993) 2006 IMEx Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. emsy_human BRCA2-interacting transcriptional repressor EMSY EMSY C11orf30 GL002 protein protein human Homo sapiens Human MPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVANAAIQHNASLPVPAETGSKEVVCYSYTSTTSTPTSTPVPSGSIATVKSPRPASPASNVVVLPSGSTVYVKSVSCSDEDEKPRKRRRTNSSSSSPVVLKEVPKAVVPVSKTITVPVSGSPKMSNIMQSIANSLPPHMSPVKITFTKPSTQTTNTTTQKVIIVTTSPSSTFVPNILSKSHNYAAVTKLVPTSVIASTTQKPPVVITASQSSLVSNSSSGSSSSTPSPIPNTVAVTAVVSSTPSVVMSTVAQGVSTSAIKMASTRLPSPKSLVSAPTQILAQFPKQHQQSPKQQLYQVQQQTQQQVAQPSPVSHQQQPQQSPLPPGIKPTIQIKQESGVKIITQQVQPSKILPKPVTATLPTSSNSPIMVVSSNGAIMTTKLVTTPTGTQATYTRPTVSPSIGRMAATPGAATYVKTTSGSIITVVPKSLATLGGKIISSNIVSGTTTKITTIPMTSKPNVIVVQKTTGKGTTIQGLPGKNVVTTLLNAGGEKTIQTVPTGAKPAILTATRPITKMIVTQPKGIGSTVQPAAKIIPTKIVYGQQGKTQVLIKPKPVTFQATVVSEQTRQLVTETLQQASRVAEAGNSSIQEGKEEPQNYTDSSSSSTESSQSSQDSQPVVHVIASRRQDWSEHEIAMETSPTIIYQDVSSESQSATSTIKALLELQQTTVKEKLESKPRQPTIDLSQMAVPIQMTQEKRHSPESPSIAVVESELVAEYITTERTDEGTEVAFPLLVSHRSQPQQPSQPQRTLLQHVAQSQTATQTSVVVKSIPASSPGAITHIMQQALSSHTAFTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSAKQQKLSQPPLEQTQLQVKTLQCFQTKQKQTIHLQADQLQHKLPQMPQLSIRHQKLTPLQQEQAQPKPDVQHTQHPMVAKDRQLPTLMAQPPQTVVQVLAVKTTQQLPKLQQAPNQPKIYVQPQTPQSQMSLPASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATSMLTGEAGSLPSTHMVVAGMANSTPQQQKCRESCSSPSTVGSSLTTRKIDPPAVPATGQFMRIQNVGQKKAEESPAEIIIQAIPQYAIPCHSSSNVVVEPSGLLELNNFTSQQLDDEETAMEQDIDSSTEDGTEPSPSQSSAERS DIP protein Q7Z589 original sequence version: 38 7F8C95E8BA0FC9F0 cbx1_human Chromobox protein homolog 1 CBX1 CBX Heterochromatin protein 1 homolog beta Modifier 1 protein M31 Heterochromatin protein p25 p25beta HP1Hsbeta protein protein human Homo sapiens Human MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN DIP protein P83916 original sequence version: 29 DIP protein P83916 original sequence version: 105 DIP protein P83916 original sequence version: 101 BE687AF9C66E48E3 cbx1-emsy-1 2 4 unspecified role unspecified role prey prey Region 9-139 Region 9-139 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role bait bait Region 104-175 Region 104-175 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag tag tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cbx1-emsy-2 3 4 unspecified role unspecified role unspecified role unspecified role Region 9-139 Region 9-139 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 104-175 Region 104-175 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cbx1-emsy-3 1 4 unspecified role unspecified role unspecified role unspecified role Region 9-139 Region 9-139 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 104-175 Region 104-175 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction