DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Elucidation of the substrate binding site of Siah ubiquitin ligase. Elucidation of the substrate binding site of Siah ubiquitin ligase. Structure (London, England : 1993) 2006 imex curation House CM., Hancock NC., Möller A., Cromer BA., Fedorov V., Bowtell DD., Parker MW., Polekhina G. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined House CM., Hancock NC., Möller A., Cromer BA., Fedorov V., Bowtell DD., Parker MW., Polekhina G. DIP original experiment: DIP-66284X Structure (London, England : 1993) 2006 IMEx Elucidation of the substrate binding site of Siah ubiquitin ligase. Elucidation of the substrate binding site of Siah ubiquitin ligase. Elucidation of the substrate binding site of Siah ubiquitin ligase. Structure (London, England : 1993) 2006 imex curation House CM., Hancock NC., Möller A., Cromer BA., Fedorov V., Bowtell DD., Parker MW., Polekhina G. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined House CM., Hancock NC., Möller A., Cromer BA., Fedorov V., Bowtell DD., Parker MW., Polekhina G. DIP original experiment: DIP-66285X Structure (London, England : 1993) 2006 IMEx Elucidation of the substrate binding site of Siah ubiquitin ligase. phyl_drome Protein phyllopod phyl CG10108 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTNQQQQANPSAAVAAPAASSEYLKRTCLICGCHTNQTINIYEPRSGPNIVQLIQAKFKFQPLNEDKFLCFSCNNWLINWHSLQAVNSNEAESQSQSPSHMGNSVLQQERTKLRPVAMVRPTVRVQPQSQPQLQPQVPINPTPAPIVYSKRRASRRSASVSRMSRVLRQCCVESLRRSPKKRNQQSVFVCLRPQGQKRSNAICKVECVAPRRKPVERLVKDVAATATPTPVLNTQSTPTYQRFPQPSVDGKVVAMFRRLGTTLSREEPAAYSAESNPACSKLPQIMSPLKEAPRWTRDLDDDEILLEFDTAISEVLPTARYQVTHEENKENQQAQEMELELEEEEEVDGRAELEVVQEAEAPLEPQSHHKQGNSHQNSHQASIQLAGLRLPMGLSISLV DIP protein Q27934 original sequence version: 39 B992F420905407A6 sia1a_mouse E3 ubiquitin-protein ligase SIAH1A Seven in absentia homolog 1a RING-type E3 ubiquitin transferase SIAH1A Siah1a protein protein mouse Mus musculus Mouse MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC DIP protein P61092 original sequence version: 36 852EADC5DD4A4FFA phyl-siah1a-1 1 3 unspecified role unspecified role unspecified role unspecified role Region 107-130 Region 107-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 unspecified role unspecified role unspecified role unspecified role Region 92-282 Region 92-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction phyl-siah1a-2 2 3 unspecified role unspecified role bait bait Region 107-130 Region 107-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST tag GST tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 4 unspecified role unspecified role prey prey Region 92-282 Region 92-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P61092:p.Met180Lys M180K mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain M K This feature has been corrected as a result of our quality control procedures. The original label was 'M180K'. Wed May 02 16:46:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met180lys' Tue Jun 30 19:42:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met180Lys' P61092:p.Leu158Asp l158D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L D Wed May 02 16:38:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu158asp' Tue Jun 30 18:57:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu158Asp' ecolx Escherichia coli direct interaction direct interaction