DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. DIP original experiment: DIP-262839X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. DIP original experiment: DIP-262838X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. DIP original experiment: DIP-262837X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. DIP original experiment: DIP-262841X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. DIP original experiment: DIP-262840X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Lottridge JM., Flannery AR., Vincelli JL., Stevens TH. DIP original experiment: DIP-262842X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Vta1p and Vps46p regulate the membrane association and ATPase activity of Vps4p at the yeast multivesicular body. snf7_yeast Vacuolar-sorting protein SNF7 SNF7 VPS32 YLR025W DID1 Vacuolar protein-sorting-associated protein 32 DOA4-independent degradation protein 1 Sucrose nonfermenting protein 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MWSSLFGWTSSNAKNKESPTKAIVRLREHINLLSKKQSHLRTQITNQENEARIFLTKGNKVMAKNALKKKKTIEQLLSKVEGTMESMEQQLFSIESANLNLETMRAMQEGAKAMKTIHSGLDIDKVDETMDEIREQVELGDEISDAISRPLITGANEVDEDELDEELDMLAQENANQETSKIVNNNVNAAPISENKVSLPSVPSNKIKQSENSVKDGEEEEDEEDEDEKALRELQAEMGL 5241A18BB181F0C1 5241A18BB181F0C1 vps4_yeast Vacuolar protein sorting-associated protein 4 VPS4 CSC1 END13 GRD13 DID6 Protein END13 DOA4-independent degradation protein 6 Vacuolar protein-targeting protein 10 VPL4 VPT10 P9705.10 YPR173C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAAKKSPSAGSGSNGGNKKISQEEGEDNGGEDNKKLRGALSSAILSEKPNVKWEDVAGLEGAKEALKEAVILPVKFPHLFKGNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESEKLVKQLFAMARENKPSIIFIDEVDALTGTRGEGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSTEDDETRKLTPCSPGDDGAIEMSWTDIEADELKEPDLTIKDFLKAIKSTRPTVNEDDLLKQEQFTRDFGQEGN E65BCDB19C9510DD E65BCDB19C9510DD vta1_yeast Vacuolar protein sorting-associated protein VTA1 VTA1 YLR181C VPS20-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSLYNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIGSSDEKTLDYADFADDSEEIKDEDVDHQTSDLENNNNDKVEGLAPKDQTTSYEPVDEVPEFIDDADSVNEEEQTVDKNEDAITKDEQQVVKKEVDLTRPSAPSEPAAAEHKSYTKDELTKIMDRASKIEQIQKLAKYAISALNYEDLPTAKDELTKALDLLNSI BB6E6975596C1674 BB6E6975596C1674 did2_yeast Vacuolar protein-sorting-associated protein 46 CHM1 FTI1 Fifty two inhibitor 1 YKR035W-A VPS46 Charged multivesicular body protein 1 DOA4-independent degradation protein 2 DID2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRNSAAGLENTLFQLKFTSKQLQKQANKASKEEKQETNKLKRALNENEDISRIYASNAIRKKNERLQLLKLASRVDSVASRVQTAVTMRQVSASMGQVCKGMDKALQNMNLQQITMIMDKFEQQFEDLDTSVNVYEDMGVNSDAMLVDNDKVDELMSKVADENGMELKQSAKLDNVPEIKAKEVNVDDEKEDKLAQRLRALRG 70D1CF4588A8C6E6 70D1CF4588A8C6E6 vps4p-vps46p-1 1 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction vta1p-vps46p-1 3 10 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association vta1p-vps32p-1 4 7 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association vta1p-vps46p-2 5 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction vps4p-vps46p-2 2 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association vps4p-vta1p-1 6 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction