DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262800X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262799X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262812X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262796X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262793X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262794X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262798X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262808X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262797X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262819X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262813X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262816X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262810X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262806X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262818X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262803X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262802X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262805X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262811X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262815X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262804X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262801X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262809X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262814X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262820X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262817X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262795X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262807X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. cxl13_mouse C-X-C motif chemokine 13 Cxcl13 Blc Scyb13 Small-inducible cytokine B13 B lymphocyte chemoattractant CXC chemokine BLC protein protein mouse Mus musculus Mouse MRLSTATLLLLLASCLSPGHGILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA DIP protein O55038 original sequence version: 118 mint Strongly chemotactic for B-lymphocytes, weakly for spleen monocytes and macrophages but no chemotactic activity for granulocytes. Binds to BLR1/CXCR5. May play a role in directing the migration of B-lymphocytes to follicles in secondary lymphoid organs F5F8AF4411C56BD3 cxl14_human C-X-C motif chemokine 14 MIP2G NJAC SCYB14 Chemokine BRAK MIP-2G Small-inducible cytokine B14 UNQ240/PRO273 PSEC0212 CXCL14 protein protein human Homo sapiens Human MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE DIP protein O95715 original sequence version: 128 C9A18B2A78CACF74 q9jft2_9poxv C3R EVH184 protein protein ectromelia virus Ectromelia virus MYKKLITFLFVIGAVASYSNNEYTPFNKLSVKLYIDGVDNIENSYTDNNELVLNFKEYTISIITESCDVGFDSIDIDVINDYKILDMYTIDSSTIQRRGHTCKISTKLSCHYDKHPYIHKYEGDERQYSITAEGKCYKGIKYEISMMHDDTLLRKHTLKIGSTYIFDRHGHSNTYYSKYDF DIP protein Q9JFT2 original sequence version: 32 tnfa_rat Tumor necrosis factor TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin Tnf Tnfa Tnfsf2 protein protein rat Rattus norvegicus (Rat) Rat MSTESMIRDVELAEEALPKKMGGLQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPNKEEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL DIP protein P16599 original sequence version: 137 B808EC6D049C2F3B cxl13_human C-X-C motif chemokine 13 Small-inducible cytokine B13 B lymphocyte chemoattractant CXC chemokine BLC B cell-attracting chemokine 1 CXCL13 BCA1 BLC SCYB13 Angie protein protein human Homo sapiens Human MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP DIP protein O43927 original sequence version: 130 4057FCA8EFF658A8 sdf1_human Stromal cell-derived factor 1 CXCL12 SDF1 SDF1A SDF1B C-X-C motif chemokine 12 Intercrine reduced in hepatomas Pre-B cell growth-stimulating factor protein protein human Homo sapiens Human MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM DIP protein P48061 original sequence version: 157 505B5A29C2B44E8D q8qmn0_cwpxb CPXV218 CDS protein protein cpv Cowpox virus (strain Brighton Red) MMIYGLIACLIFVTSSTASPLYIPVIPPITEDKSFNSVEVLVSLFRDEQKDYTVTSQFNNYTIDTKDWTINVLSTPDGLEIPLTNITYWSRFPTIGHALFKSESEDIFQKNMSILGVSIECKKPSTSFTFLTVRKISRVFNRFPDMAYYRGDCLEVVYVTMTYKNTKTGETDYTYLSNVGIPEYYRLMSGVDG DIP protein Q8QMN0 original sequence version: 24 tnfa_human Tumor necrosis factor TNF TNFA TNFSF2 TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin protein protein human Homo sapiens Human MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL DIP protein P01375 original sequence version: 198 DIP protein P01375 original sequence version: 151 DIP protein P01375 original sequence version: 156 DIP protein P01375 original sequence version: 186 DIP protein P01375 original sequence version: 201 DIP protein P01375 original sequence version: 174 DIP protein P01375 original sequence version: 211 3DF90F96C9031FFE q8jlj0_9poxv EVM008 protein protein ectromelia virus Ectromelia virus MINININTILIFASLFVASFANDYPPPGFFENKYITDTFNYISIDFELYPVNVSSCNRLSTKQSSDIITTSELTITVNSTDCDPVFVTEYYSIKDKTAVAGLFTDTTKKQNTSKMCTLNVEVKCNAETEPVLIGNFTRVPETASTHAENFTLIGNCLSDLHLYIVYVNTDEGFEEDTATIHIGNMIDISGIPPNTCATRTIN DIP protein Q8JLJ0 original sequence version: 25 tnfa_mouse Tumor necrosis factor TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin Tnf Tnfa Tnfsf2 protein protein mouse Mus musculus Mouse MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL DIP protein P06804 original sequence version: 163 16DD2A9676D68C5D ccl25_mouse C-C motif chemokine 25 Ccl25 Scya25 Teck Small-inducible cytokine A25 Thymus-expressed chemokine Chemokine TECK protein protein mouse Mus musculus Mouse MKLWLFACLVACFVGAWMPVVHAQGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN DIP protein O35903 original sequence version: 106 mint Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9 CEC1924B320B4408 crmb_var67 Cytokine response-modifying protein B CRMB Viral tumor necrosis factor receptor II G2R G4R protein protein varv Variola virus (isolate Human/India/Ind3/1967) VARV Smallpox virus MKSVLYLYILFLSCIIINGRDAAPYTPPNGKCKDTEYKRHNLCCLSCPPGTYASRLCDSKTNTQCTPCGSGTFTSRNNHLPACLSCNGRCNSNQVETRSCNTTHNRICECSPGYYCLLKGSSGCKACVSQTKCGIGYGVSGHTSVGDVICSPCGFGTYSHTVSSADKCEPVPNNTFNYIDVEITLYPVNDTSCTRTTTTGLSESILTSELTITMNHTDCNPVFREEYFSVLNKVATSGFFTGENRYQNISKVCTLNFEIKCNNKGSSFKQLTKAKNDDGMMSHSETVTLAGDCLSSVDIYILYSNTNAQDYETDTISYRVGNVLDDDSHMPGSCNIHKPITNSKPTRFL DIP protein P34015 original sequence version: 87 ccl20_human C-C motif chemokine 20 CCL20 LARC MIP3A SCYA20 Beta-chemokine exodus-1 CC chemokine LARC Liver and activation-regulated chemokine Macrophage inflammatory protein 3 alpha Small-inducible cytokine A20 protein protein human Homo sapiens Human MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM DIP protein P78556 original sequence version: 143 1ED19EC2E1AC70AD sdf1_mouse Stromal cell-derived factor 1 Cxcl12 Sdf1 12-O-tetradecanoylphorbol 13-acetate repressed protein 1 C-X-C motif chemokine 12 Pre-B cell growth-stimulating factor Thymic lymphoma cell-stimulating factor protein protein mouse Mus musculus Mouse MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM DIP protein P40224 original sequence version: 130 o57300_9poxv Cytokine response-modifying protein B crmD EVM003 I1R EVH006 EVH201 protein protein ectromelia virus Ectromelia virus MMKMTPSYILLVYMFVVVSGDVPYTPINGKCNGTDYNSNNLCCKQCNPGMYMTHSCNTTSNTKCDKCPDDTFTSIPNHSPACLSCRGKCSSNQVETKSCSNTQDRVCVCASGYYCEFEGSNGCRLCVPQTKCGSGYGVYGYSSKGDVICKKCPGNIDKCDLSFNSIDVEINMYPVNKTSCNSSIGSSSTISTSELTITLTHEDCTPVFIGDYYSVVDKLATSGFFTNDKVHQDLTTQCKINLEIKCNSGRESRQLTPTTKVYFMPHSETVTVVGDCLSNLDVYIVYANTDAIYSDMDVVAYHTSYILNVDHIPPNDCERD DIP protein O57300 original sequence version: 67 ccl25_human C-C motif chemokine 25 CCL25 SCYA25 TECK Small-inducible cytokine A25 Thymus-expressed chemokine Chemokine TECK protein protein human Homo sapiens Human MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL DIP protein O15444 original sequence version: 121 mint Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1 91D0810F137FBC7B tnfb_human Lymphotoxin-alpha TNF-beta Tumor necrosis factor ligand superfamily member 1 LTA TNFB TNFSF1 protein protein human Homo sapiens Human MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL DIP protein P01374 original sequence version: 166 1BBD5E7D496A3A82 xcl1_human Lymphotactin XCL1 ATAC C motif chemokine 1 Cytokine SCM-1 LTN Lymphotaxin SCM-1-alpha SCYC1 Small-inducible cytokine C1 XC chemokine ligand 1 protein protein human Homo sapiens Human MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG DIP protein P47992 original sequence version: 132 DIP protein P47992 original sequence version: 72 DIP protein P47992 original sequence version: 138 FABA16063C3FC165 ccl28_human C-C motif chemokine 28 Mucosae-associated epithelial chemokine CCL28 SCYA28 Small-inducible cytokine A28 Protein CCK1 protein protein human Homo sapiens Human MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY DIP protein Q9NRJ3 original sequence version: 123 Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner mint 3E8551A63A2C8D62 q9yp87_cowpx CPXV191 crmC protein protein cowpx Cowpox virus CPV MDIKNLLTVCTILYISTLVTADIPTSSLPHAPVNGSCDDGEYLDKTHNQCCNRCPPGEFAKIRCSGSDNTKCERCPPHTYTTVPNYSNGCHQCRKCPTGSFDKVKCTGTQNSKCSCLPGWFCATDSSKTEDCRDCIPKRKCPCGYFGGIDELGNPLCKSCCVGEYCDDIRNHRVGPFPPCKLSKCN DIP protein Q9YP87 original sequence version: 46 crmb-tnf-1 5 36 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmd-ccl20-1 20 43 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper 41 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction evm008-ccl25-1 16 39 unspecified role unspecified role prey prey ecolx Escherichia coli 37 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-tnf-2 6 32 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction evm008-cxcl12-1 18 42 unspecified role unspecified role prey prey ecolx Escherichia coli 37 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction evm008-cxcl13-1 21 29 unspecified role unspecified role prey prey ecolx Escherichia coli 37 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-cxcl14-1 24 30 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-tnf-3 27 38 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction c3r-ccl25-1 14 39 unspecified role unspecified role prey prey ecolx Escherichia coli 31 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmd-cxcl12-1 15 34 unspecified role unspecified role prey prey ecolx Escherichia coli 43 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-lta-1 4 45 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmd-ccl28-1 12 47 unspecified role unspecified role prey prey ecolx Escherichia coli 43 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-ccl25-1 9 44 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait Region 194-348 Region 194-348 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmd-ccl25-1 26 39 unspecified role unspecified role prey prey ecolx Escherichia coli 43 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction c3r-cxcl13-1 28 29 unspecified role unspecified role prey prey ecolx Escherichia coli 31 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-ccl28-1 23 47 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmd-cxcl14-1 25 30 unspecified role unspecified role prey prey ecolx Escherichia coli 43 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmc-ccl25-1 7 44 unspecified role unspecified role prey prey ecolx Escherichia coli 48 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction c3r-cxcl12-1 8 42 unspecified role unspecified role prey prey ecolx Escherichia coli 31 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmc-tnf-1 2 36 unspecified role unspecified role prey prey ecolx Escherichia coli 48 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmd-cxcl13-1 10 33 unspecified role unspecified role prey prey ecolx Escherichia coli 43 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-ccl20-1 13 41 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction cpxv218 cds-ccl25-1 1 39 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction cpxv218 cds-cxcl13-1 22 29 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-xcl1-1 19 46 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-cxcl13-1 11 33 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction crmb-cxcl12-1 3 34 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction cpxv218 cds-cxcl12-1 17 42 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction