DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Analysis of protein solvent interactions in glucose dehydrogenase from the extreme halophile Haloferax mediterranei. Analysis of protein solvent interactions in glucose dehydrogenase from the extreme halophile Haloferax mediterranei. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Britton KL., Baker PJ., Fisher M., Ruzheinikov S., Gilmour DJ., Bonete MJ., Ferrer J., Pire C., Esclapez J., Rice DW. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Britton KL., Baker PJ., Fisher M., Ruzheinikov S., Gilmour DJ., Bonete MJ., Ferrer J., Pire C., Esclapez J., Rice DW. DIP original experiment: DIP-262771X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Analysis of protein solvent interactions in glucose dehydrogenase from the extreme halophile Haloferax mediterranei. glcdh_halmt Glucose 1-dehydrogenase gdh HFX_1090 protein protein halmt Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) Halobacterium mediterranei MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV DIP protein Q977U7 original sequence version: 69 gdh-1 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction