DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262764X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm density sedimentation cosedimentation through density gradient density sedimentation weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262767X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm density sedimentation cosedimentation through density gradient density sedimentation weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262766X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262761X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip weight silver stain molecular weight estimation by silver staining weight silver stain Ranjan A., Gossen M. DIP original experiment: DIP-262759X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm density sedimentation cosedimentation through density gradient density sedimentation weight silver stain molecular weight estimation by silver staining weight silver stain Ranjan A., Gossen M. DIP original experiment: DIP-262760X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262762X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262769X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262770X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262768X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm density sedimentation cosedimentation through density gradient density sedimentation weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262765X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. A structural role for ATP in the formation and stability of the human origin recognition complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ranjan A., Gossen M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Ranjan A., Gossen M. DIP original experiment: DIP-262763X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A structural role for ATP in the formation and stability of the human origin recognition complex. orc4_human Origin recognition complex subunit 4 ORC4 ORC4L protein protein human Homo sapiens Human MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL DIP protein O43929 original sequence version: 134 DIP protein O43929 original sequence version: 65 A7020B6690E30B4E orc3_human Origin recognition complex subunit 3 ORC3 LATHEO Origin recognition complex subunit Latheo ORC3L protein protein human Homo sapiens Human MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPFKINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSNNQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLHKFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFKSYCENHLGSTAKRIEEFLAQFQSLDETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELRRSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALHTALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC DIP protein Q9UBD5 original sequence version: 124 DIP protein Q9UBD5-1 original sequence version: 96 DIP protein Q9UBD5 original sequence version: 100 E713569A11B39B1C orc1_human Origin recognition complex subunit 1 ORC1 ORC1L PARC1 Replication control protein 1 protein protein human Homo sapiens Human MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPACDSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELGNLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQPDKLQTLSPALKAPEKTRETGLSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPSVILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSSSDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKDE DIP protein Q13415 original sequence version: 131 DIP protein Q13415 original sequence version: 64 DIP protein Q13415 original sequence version: 100 DIP protein Q13415 original sequence version: 105 5C594553F7F808E2 orc6_human Origin recognition complex subunit 6 ORC6 ORC6L protein protein human Homo sapiens Human MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE DIP protein Q9Y5N6 original sequence version: 119 DIP protein Q9Y5N6 original sequence version: 56 DIP protein Q9Y5N6 original sequence version: 130 78840387605F45FE orc5_human Origin recognition complex subunit 5 ORC5 ORC5L protein protein human Homo sapiens Human MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVFVNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTVYIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFPDYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIARTVNFDIIKYLYDFL DIP protein O43913 original sequence version: 116 DIP protein O43913 original sequence version: 53 DIP protein O43913 original sequence version: 90 0FEB0E829C124745 orc2_human Origin recognition complex subunit 2 ORC2 ORC2L protein protein human Homo sapiens Human MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKSVSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA DIP protein Q13416 original sequence version: 117 DIP protein Q13416 original sequence version: 56 DIP protein Q13416 original sequence version: 94 DF3F9C2CF147DA5F orc1-orc2-16 11 17 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association orc2-orc1-6 5 16 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association orc1-orc2-17 6 17 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association orc2-orc3-1 12 17 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association orc1-orc2-18 10 17 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association orc2-orc3-4 3 17 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association orc1-orc4-8 8 17 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association orc2-orc3-11 1 17 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association orc2-orc3-12 7 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association orc2-orc1-7 4 17 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association orc2-orc3-13 2 17 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association orc2-orc3-14 9 17 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association