DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural determinants of selective alpha-conotoxin binding to a nicotinic acetylcholine receptor homolog AChBP. Structural determinants of selective alpha-conotoxin binding to a nicotinic acetylcholine receptor homolog AChBP. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ulens C., Hogg RC., Celie PH., Bertrand D., Tsetlin V., Smit AB., Sixma TK. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ulens C., Hogg RC., Celie PH., Bertrand D., Tsetlin V., Smit AB., Sixma TK. DIP original experiment: DIP-262658X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural determinants of selective alpha-conotoxin binding to a nicotinic acetylcholine receptor homolog AChBP. q8wsf8_aplca protein protein aplca Aplysia californica (California sea hare) California sea hare MLVSVYLALLVACVGQAHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD DIP protein Q8WSF8 original sequence version: 59 DIP protein Q8WSF8 original sequence version: 69 DIP protein Q8WSF8 original sequence version: 24 DIP protein Q8WSF8 original sequence version: 30 DIP protein Q8WSF8 original sequence version: 37 DIP protein Q8WSF8 original sequence version: 74 mint 6D0DE487C46707BE ca1_conim Alpha-conotoxin ImI protein protein conim Conus imperialis Imperial cone IVRRGCCSDPRCAWRCG DIP protein P50983 original sequence version: 88 ca1_conim-q8wsf8_aplca-1 1 2 unspecified role unspecified role unspecified role unspecified role Region 20-236 Region 20-236 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 3 unspecified role unspecified role unspecified role unspecified role Region 5-16 Region 5-16 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction