DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A hydrophobic binding surface on the human immunodeficiency virus type 1 Nef core is critical for association with p21-activated kinase 2. A hydrophobic binding surface on the human immunodeficiency virus type 1 Nef core is critical for association with p21-activated kinase 2. Journal of virology 2006 imex curation Agopian K., Wei BL., Garcia JV., Gabuzda D. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Agopian K., Wei BL., Garcia JV., Gabuzda D. DIP original experiment: DIP-266692X Journal of virology 2006 IMEx A hydrophobic binding surface on the human immunodeficiency virus type 1 Nef core is critical for association with p21-activated kinase 2. pak2_human Serine/threonine-protein kinase PAK 2 p21-activated kinase 2 Gamma-PAK PAK65 S6/H4 kinase p58 PAK2 protein protein human Homo sapiens Human MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR DIP protein Q13177 original sequence version: 166 DIP protein Q13177 original sequence version: 114 00A7CD15F93D4180 q2hzl0_9hiv1 Protein Nef nef 3'ORF Negative factor protein protein 9hiv1 Human immunodeficiency virus 1 MGGKWSKRSRDGWASVRERMRQAEPRAEPAAEGVGPASRDLERHGAITSSNTAANNATLAWLEAQEEEEEVGFPVRPQVPLRPMTYKGAFDLSFFLKEKGGLEGLIWSQKRQDILDLWVYHTQGFLPDWQCYTPGPGVRYPLTFGWCFKLVPVEPEKVEEANEGENNCLLHPMSQHGMDDPEKEVLVWKFDIHLAHHHIAREKHPEYFKNC DIP protein Q2HZL0 original sequence version: 47 nef-pak2-1 1 2 unspecified role unspecified role prey prey Q13177:p.Lys278Arg K278R mutation mutation certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K278R'. Wed May 02 14:55:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys278arg' Tue Jun 30 16:06:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys278Arg' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 3 unspecified role unspecified role bait bait Q2HZL0:p.Phe94His F94H mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F H This feature has been corrected as a result of our quality control procedures. The original label was 'F94H'. Wed May 02 19:58:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe94his' Tue Jun 30 19:26:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe94His' human Homo sapiens Human physical association physical association