DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Proteinase 3 is an IL-32 binding protein. Proteinase 3 is an IL-32 binding protein. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. DIP original experiment: DIP-262640X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Proteinase 3 is an IL-32 binding protein. Proteinase 3 is an IL-32 binding protein. Proteinase 3 is an IL-32 binding protein. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. Only protein-protein interactions in vitro In vitro pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. DIP original experiment: DIP-262638X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Proteinase 3 is an IL-32 binding protein. Proteinase 3 is an IL-32 binding protein. Proteinase 3 is an IL-32 binding protein. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. DIP original experiment: DIP-262639X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Proteinase 3 is an IL-32 binding protein. p24001-4 Interleukin-32 IL32 NK4 TAIF Natural killer cells protein 4 Tumor necrosis factor alpha-inducing factor Alpha protein protein human Homo sapiens Human MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK DIP protein P24001-4 original sequence version: 103 prtn3_human Myeloblastin MBN PRTN3 Leukocyte proteinase 3 AGP7 Wegener autoantigen P29 C-ANCA antigen Neutrophil proteinase 4 protein protein human Homo sapiens Human MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP DIP protein P24158 original sequence version: 161 CBECA36D8C4B2A40 il32-prtn3-1 2 5 unspecified role unspecified role prey prey human Homo sapiens Human 4 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association il32-prtn3-2 3 5 unspecified role unspecified role prey prey human Homo sapiens Human 4 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction il32-prtn3-3 1 5 enzyme enzyme unspecified role unspecified role human Homo sapiens Human 4 enzyme target enzyme target substrate substrate unspecified role unspecified role 125I-label 125I-label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli protein cleavage protein cleavage