DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structure of a ring-opened proliferating cell nuclear antigen-replication factor C complex revealed by fluorescence energy transfer. The structure of a ring-opened proliferating cell nuclear antigen-replication factor C complex revealed by fluorescence energy transfer. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zhuang Z., Yoder BL., Burgers PM., Benkovic SJ. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Zhuang Z., Yoder BL., Burgers PM., Benkovic SJ. DIP original experiment: DIP-262584X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The structure of a ring-opened proliferating cell nuclear antigen-replication factor C complex revealed by fluorescence energy transfer. The structure of a ring-opened proliferating cell nuclear antigen-replication factor C complex revealed by fluorescence energy transfer. The structure of a ring-opened proliferating cell nuclear antigen-replication factor C complex revealed by fluorescence energy transfer. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Zhuang Z., Yoder BL., Burgers PM., Benkovic SJ. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Zhuang Z., Yoder BL., Burgers PM., Benkovic SJ. DIP original experiment: DIP-262585X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The structure of a ring-opened proliferating cell nuclear antigen-replication factor C complex revealed by fluorescence energy transfer. pcna_yeast Proliferating cell nuclear antigen YBR0811 YBR088C POL30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 9B56C5851621DDDC 9B56C5851621DDDC pcna-9 1 3 unspecified role unspecified role fluorescence donor fluorescence donor P15873:p.Phe185Trp F185W mutation mutation certain certain sequence position certain certain certain sequence position certain F W This feature has been corrected as a result of our quality control procedures. The original label was 'F185W'. Wed May 02 14:37:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe185trp' Tue Jun 30 16:57:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe185Trp' ecolx Escherichia coli 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pcna-10 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction