DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262563X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262564X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262565X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262562X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight silver stain molecular weight estimation by silver staining weight silver stain Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262558X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262559X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262561X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262560X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262556X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262566X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. Only protein-protein interactions ecolx Escherichia coli density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Noirot-Gros MF., Velten M., Yoshimura M., McGovern S., Morimoto T., Ehrlich SD., Ogasawara N., Polard P., Noirot P. DIP original experiment: DIP-262557X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Functional dissection of YabA, a negative regulator of DNA replication initiation in Bacillus subtilis. tlpa_bacsu Methyl-accepting chemotaxis protein TlpA BSU31250 tlpA protein protein bacsu Bacillus subtilis MKKTLTTIRRSSIARRLIISFLLILIVPITALSVSAYQSAVASLDVQMTQSAKENVQILDHIIDDKISTTEKSLAYFSDWATAEKFQDKKKTELKQEFKQFIQMNDNVAAVFSSGKDGDFTRYPYADMPSDFNALERDWYKEAMANKGKTIVTEPYESISSGKMVVTIARQTVDGSGVVAIDMKIDDLVTTAKGINIGKEGYAFILSQNKKVIAYSGEKAGTELKGDWVDKLYKDKSGDFEYTYKGKKKKMAFATSQTTGWKISGTMYANEIHDAASRVLIMASIVLAIAIGAGMTAIYFVIRSITKPLRRIVASAEKISEGDLTETIEINSKDELGVLSESFNHMAHSLRSLIHGIKDSVEHVASSSEELTASADQTSRATEHITMAIEQFSNGSESQSEKIETTTEQINEMNDGLAELARAAAVITETSADSTEVSSKGETLVQKTAGQMNTIDHSVKAAEQVVKGLEIKSKDITNILRVINGIADQTNLLALNAAIEAARAGEYGRGFSVVAEEVRKLAVQSADSAKEIESLISEIVKEIHTSLNVLQSVNKEVETGLVMTDETKQSFKHISQMTNQIASELQNMNATVEELSAGAQEISAASNDITAISKESSDGIQDIAASAEEQLASMEEISSSALTLERMSEELRDLTKQFKVDK DIP protein P39216 original sequence version: 108 7335B27992D07FF6 dpo3b_bacsu Beta sliding clamp Beta-clamp processivity factor DNA polymerase III beta sliding clamp subunit DNA polymerase III subunit beta dnaG BSU00020 dnaN protein protein bacsu Bacillus subtilis MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFTGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLTIIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILTGVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY DIP protein P05649 original sequence version: 107 C1F040B5D53026C8 yaba_bacsu Initiation-control protein YabA BSU00330 yabA protein protein bacsu Bacillus subtilis MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIEKFKADKKESKTQKTEQTDIGEGYDNLARLYQEGFHICNVHYGSVRKEDCLFCLSFLNKK DIP protein P37542 original sequence version: 88 8DE24ADA44444721 acub_bacsu Acetoin utilization protein AcuB acuB BSU29700 protein protein bacsu Bacillus subtilis MIVEQIMKRDVITLTKTDTLETAICKLKEFHIRHLPVVDEERHVIGMITDRDMKQASPSIFEENKRSLFLTRSVDSIMKKDVVCAHPLDFVEEISAVFYEHGIGCLPVVHHQKLIGILTKTDLLRTFVKLTGADQPGSQIEIKVNDITKSLAEISSLCQDLQVKILSVLVYPHDDPGVKVLVFRVKTMNPLPFLQALQRNGHHVVWPSEQRDLL DIP protein P39066 original sequence version: 94 3B7A964B5C95CCEF dnaa_bacsu Chromosomal replication initiator protein DnaA dnaA dnaH BSU00010 protein protein bacsu Bacillus subtilis MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKEDTSDFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK DIP protein P05648 original sequence version: 118 DIP protein P05648 original sequence version: 130 666799A0A183C992 dnaa-yaba-1 8 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction yaba-1 9 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction yaba-dnan-1 1 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait P37542:p.Leu27Ala L27A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L27A'. Wed May 02 15:14:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu27ala' Tue Jun 30 20:10:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu27Ala' P37542:p.Val99Ala V99A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V99A'. Wed May 02 20:26:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val99ala' Tue Jun 30 18:57:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val99Ala' P37542:p.Leu110Pro L110P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L110P'. Wed May 02 18:01:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu110pro' Tue Jun 30 20:22:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu110Pro' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yaba-2 11 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction yaba-acub-1 3 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait P37542:p.Leu27Ala L27A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L27A'. Wed May 02 15:51:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu27ala' Tue Jun 30 16:00:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu27Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dnan-yaba-1 7 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction yaba-3 5 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction yaba-dnaa-1 4 14 unspecified role unspecified role bait bait P37542:p.Leu27Ala L27A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L27A'. Wed May 02 17:22:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu27ala' Tue Jun 30 18:44:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu27Ala' P37542:p.Asn85Asp N85D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain N D This feature has been corrected as a result of our quality control procedures. The original label was 'N85D'. Wed May 02 17:24:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn85asp' Tue Jun 30 18:59:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn85Asp' P37542:p.Leu86Pro L86P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L86P'. Wed May 02 16:12:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu86pro' Tue Jun 30 16:54:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu86Pro' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yaba-4 6 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction yaba-tlpa-1 2 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait P37542:p.Leu27Ala L27A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L27A'. Wed May 02 15:23:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu27ala' Tue Jun 30 17:55:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu27Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yaba-yaba-1 10 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association