DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Nature structural & molecular biology 2005 imex curation Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254819X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Nature structural & molecular biology 2005 imex curation Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254820X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Nature structural & molecular biology 2005 imex curation Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254818X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Nature structural & molecular biology 2005 imex curation Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254816X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Nature structural & molecular biology 2005 imex curation Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254815X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Nature structural & molecular biology 2005 imex curation Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254817X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. trub_metja Probable tRNA pseudouridine synthase B truB tRNA pseudouridine(55) synthase tRNA pseudouridylate synthase tRNA-uridine isomerase MJ0148 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MILLEKTQEKKINDKEELIVKEEVETNWDYGCNPYERKIEDLIKYGVVVVDKPRGPTSHEVSTWVKKILNLDKAGHGGTLDPKVTGVLPVALERATKTIPMWHIPPKEYVCLMHLHRDASEEDILRVFKEFTGRIYQRPPLKAAVKRRLRIRKIHELELLDKDGKDVLFRVKCQSGTYIRKLCEDIGEALGTSAHMQELRRTKSGCFEEKDAVYLQDLLDAYVFWKEDGDEEELRRVIKPMEYGLRHLKKVVVKDSAVDAICHGADVYVRGIAKLSKGIGKGETVLVETLKGEAVAVGKALMNTKEILNADKGVAVDVERVYMDRGTYPRMWKRKK DIP protein Q57612 original sequence version: 85 F29E3EC979A5A89A nop10_yeast H/ACA ribonucleoprotein complex subunit NOP10 YHR072W-A Nucleolar protein family A member 3 snoRNP protein NOP10 NOP10 Nucleolar protein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 4718D35AF7911FBA 4718D35AF7911FBA nop10_metja Ribosome biogenesis protein Nop10 nop10 MJ0116.1 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MVEMRMKKCPKCGLYTLKEICPKCGEKTVIPKPPKFSLEDRWGKYRRMLKRALKNKNKAE DIP protein P81303 original sequence version: 64 F803BDAF7F216DE7 nop10-trub-1 5 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nop10-trub-2 3 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction trub-ynop10-1 4 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nop10-trub-3 1 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nop10-trub-4 6 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction trub-nop10-1 2 9 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association