DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. Virology 2004 imex curation Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. DIP original experiment: DIP-266718X Virology 2004 IMEx A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. Virology 2004 imex curation Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. DIP original experiment: DIP-266723X Virology 2004 IMEx A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. Virology 2004 imex curation Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. DIP original experiment: DIP-266721X Virology 2004 IMEx A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. Virology 2004 imex curation Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. DIP original experiment: DIP-266719X Virology 2004 IMEx A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. Virology 2004 imex curation Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. DIP original experiment: DIP-266720X Virology 2004 IMEx A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. Virology 2004 imex curation Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Fang J., Kubota S., Yang B., Zhou N., Zhang H., Godbout R., Pomerantz RJ. DIP original experiment: DIP-266722X Virology 2004 IMEx A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. rev_hv1h2 Protein Rev rev ART/TRS Anti-repression transactivator Regulator of expression of viral proteins protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE DIP protein P04618 original sequence version: 105 DIP protein P04618 original sequence version: 107 4BCF5059C9A7F3B2 q92499-1 ATP-dependent RNA helicase DDX1 DEAD box protein 1 DEAD box protein retinoblastoma DDX1 protein protein human Homo sapiens Human MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF DIP protein Q92499-1 original sequence version: 146 rev-ddx1-1 6 7 unspecified role unspecified role bait bait human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association rev-ddx1-2 1 7 unspecified role unspecified role bait bait Region 10-24 Region 10-24 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey Region 189-333 Region 189-333 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ddx1-rev-1 5 7 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rev-ddx1-3 4 7 unspecified role unspecified role bait bait Region 10-24 Region 10-24 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 12-17 Region 12-17 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 8 unspecified role unspecified role prey prey Region 189-333 Region 189-333 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association ddx1-rev-2 2 7 unspecified role unspecified role prey prey Gal4-tag Gal4-tag gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association rev-ddx1-4 3 7 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction