UniProt UniProt http://www.uniprot.org Identification and functional analysis of the essential and regulatory light chains of the only type II myosin Myo1p in Saccharomyces cerevisiae. Identification and functional analysis of the essential and regulatory light chains of the only type II myosin Myo1p in Saccharomyces cerevisiae. The Journal of Cell Biology 2004 imex curation Luo J., Vallen EA., Dravis C., Tcheperegine SE., Drees B., Bi E. ebi@mail.med.upenn.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Luo J., Vallen EA., Dravis C., Tcheperegine SE., Drees B., Bi E. ebi@mail.med.upenn.edu Accepted 2018-JAN-19 AT 13:59 GMT AT 13:59 GMT by PPORRAS The Journal of Cell Biology 2004 Only protein-protein interactions imex curation imex curation Identification and functional analysis of the essential and regulatory light chains of the only type II myosin Myo1p in Saccharomyces cerevisiae. Identification and functional analysis of the essential and regulatory light chains of the only type II myosin Myo1p in Saccharomyces cerevisiae. The Journal of Cell Biology 2004 imex curation Luo J., Vallen EA., Dravis C., Tcheperegine SE., Drees B., Bi E. ebi@mail.med.upenn.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Luo J., Vallen EA., Dravis C., Tcheperegine SE., Drees B., Bi E. ebi@mail.med.upenn.edu Accepted 2018-JAN-19 AT 13:59 GMT AT 13:59 GMT by PPORRAS The Journal of Cell Biology 2004 Only protein-protein interactions imex curation imex curation myo2_yeast Myosin-2 MYO2 CDC66 YOR326W O6167 Class V unconventional myosin MYO2 Type V myosin heavy chain MYO2 Cell division control protein 66 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQSTEQTLKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGDLQNEVKSLKEEIARLQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSGNNHIDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWLKKLQKQLQKKAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYVADIVKKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVEAYIPAWLSLPSTKRIVDLVAQQVVQDGH 1F7E2887C1E59D54 1F7E2887C1E59D54 mlc2_yeast Myosin light chain 2 MLC2 YPR188C P9677.10 MYO1 light chain 2 Myosin-1 light chain Calmodulin-like myosin light chain MLC2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDHSESLTFNQLTQDYINKLKDAFQMLDEDEDGLISRGDLTKIYATLGKTLTDEEWSKMVPDNDTSTAEVGEEGVSFPIFLSIMGKNLSQFPEREELEESLKAIGRGHDLNVPLNEVIDSLKEAGFENPEEEFAKLFKLFTTNQQATEERTFRGKLFLDSITD 6BAE6EA0ADF66B9B 6BAE6EA0ADF66B9B iqg1_yeast Ras GTPase-activating-like protein IQG1 IQG1 CYK1 IQGAP-related protein 1 Cytokinesis protein 1 YPL242C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAYSGSPSKPGNNNSYLNRYVENLGTNVTPPLRPQSSSKINSSLNIASPSHLKTKTSASNSSATILSKKVESSVSKLKPSLPNKLVGKYTVDLSNYSKIELRYYEFLCRVSEVKIWIEAVIEEALPSEIELCVGDSLRNGVFLAKLTQRINPDLTTVIFPAGDKLQFKHTQNINAFFGLVEHVGVPDSFRFELQDLYNKKNIPQVFETLHILISMINKKWPGKTPALTNVSGQISFTKEEIAACKKAWPRIRDFKSLGTNINTAPASPEEPKEKRSGLIKDFNKFERPNIPVEEILITPRKNITDANCSDFSNTPSPYNEAPKMSNLDVVVEKRKFTPIEPSLLGPTPSLEYSPIKNKSLSYYSPTISKYLTYDTEFYTRRSRAREEDLNYYQTFKYSPSHYSPMRRERMTEEQFLEKVVQLQNICRGVNTRFNLYIQKRLLNLFEQDILRFQACLRGNKFRVLSSMYLPIRRAKIDVPHVEAIQSRIKGSRIRYKYDKLKFTLSRFSCTVELLQAYCRSKLLKTTVNTKLNDIEISHYPLTKLQSYMRASYVRKKVMSLNTKLNDERESIMKFSAIIRGNVVRCSEDAILSAVHDVHKENISKLQSLIRGIFTRSCLASIIYSLGKENCNIIQLSACIRGNAVRHKVQSLFAPENNLSETVHDLQGLVRGILVRYTLDLVDDIVEYNNLALFQAFSRGALVRESLDQKSSFYKRNVRSVIMIQSWIRKSLQRSAYLELLDCPNPSLWAVKKFVHLLNGTATIEEVQNQLESCQASLDSENMKKERLLKSIRQQLNINGVLDKFGLLKDKDHELGISDSTIPKSKYQKYEKLFYMLQVDPSYWKLLYLKEPEFVAKNVYMTFGTVNQRMNDRERSYFTRFVCEMLQNAINEAPSIESFLDNRSQFWQTILQDFLRRESPEFFSIIVPVLDYLSDPVVDFESDPYKIYQEIHGFSSPQHCSPVDDASTKNKFIDNLRCLWHAIEMVAEIYTRKVHTIPVEIRYLCTKIFCYAADKNIEEIDSLRAISSILVNVFVSEYLVNREYYGYKDSNVQKNNQKIDILMKSLATVFEIKNFDGFLDPLNQYANEIKPHIKDVLYNVLVDPEYEQEGDRLIYLDMVSPSPKLELLTEKVLEISGKFEEYLNEFPEADILHDILEKNLDNSSFPRSGRVTLELDASAYRFLVSDDKMRKIYDQVKRAFVYMMQIEDVDTNLYDLSISTILPQDEPNFANFLEQNPKIRDDPMIQKLKPLKYFTLKNVTLKKIHELESTGTFCSSDNKLQNFLNDIANTIKNPNYAIDYVTQEIYITKETLTKISEMNHSLDIELSRLKKHVDHTIKDFQKAKDFSPVHKSKFGNFKNAVKKVQGRERSELQGMKFKWNTKQLYERGVLKTIRGEKLAELTVKVFGSSGPKFPDIIFKISTSDGSRFGIQMIDKRKGPDKRYSDDVDSFSFKDLIKTQVEPKIETWKLFHSNVVVNNSQLLHLIVSFFYKRNAL C0C7582808154DCC myo1_yeast Myosin-1 MYO1 Type II myosin YHR023W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGGQSCSSNMIVWIPDEKEVFVKGELMSTDINKNKFTGQEEQIGIVHPLDSTEVSNLVQVRISDVFPVNPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEFVSDRAEQASFKNDVSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNLDHGSATLNYIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLPKSTDESFYSKLISTWDQNSSKFKRSRLKNGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEITYHLQKLKKTRVIGNTFRLYNRLVKEDPWFNLFIRIKPLLTSSNDMTRTKKFNEQINKLKNDLQEMESKKKFLEEKNQKTVNELENTQDLLNQEKENLRKNESLLNRVKTSSETLQKQFDDLVSEKDEISREKLEVAQNLEEAHQKIQGLQETIREREATLEKLHSKNNELIKQISDLNCDISKEQSSQSLIKESKLKLENEIKRLKDVINSKEEEIKSFNDKLSSSEEDLDIKLVTLEKNCNIAMSRLQSLVTENSDLRSKNENFKKEKAALNNQLKNKESELLKMKEKIDNHKKELATFSKQRDDAVSEHGKITAELKETRIQLTEYKSNYQKIKEEYSNFQRETKEQEQKKRNSLVESLNDSKIKELEARLSQEISLNQYLNKRISGNSVETNISSTRRSTSYSDDPLDKEDIIKKYYDLQLAFTEITRNLENEIEEKKNLISRLRFTETRLASSSFEDQKIKAQMKKLKKLIQDMDPSIPLDSILNEPLDNCPDKESDINKLMLEVDYLKRQLDIETRAHYDAENAISALHSKFRKIQGESSLSSSDIYKLKFEASEERVKSLEDKLKTMPLRDRTNLPVGDIIKNRDSISKYEEEIRYYKLENYKLQEILNESNGKLSQLTLDLRQSKSKEALLSEQLDRLQKDLESTERQKELLSSTIKQQKQQFENCMDDLQGNELRLREHIHALKQAEEDVKNMASIIEKLKTQNKQKEKLIWEREMERNDSDMQLQETLLELKRVQDVKKILSDDLAHLKERLSAVEDRSQYTDEINRLKEELNCSLKAETNLKKEFATLKYKLETSTNDSEAKISDLLKQLDHYTKVVEMLNNEKDAISLAEKELYQKYEALNTECESLKGKIVSLTKIKQELESDLNQKTDALQISNAALSSSTQKNKEITEKIKYLEETLQLQMEQNSRNGELVKTLQASCNGYKDKFDDEKQKNIDLYEENQTLQKLNTDLQLQLKNLHERLSDTTEKNAWLSKIHELENMVSLETDLKYEEMKKNKSLERAVEELQTKNSQQTDVIELANKNRSEFEEATLKYEAQISDLEKYISQQELEMKKSIRDNSSYRDKVQEMAQEIEFWKSRYESTMIGSKNIDSNNAQSKIFS 6F54C7611F43DC9F 6F54C7611F43DC9F mlc1_yeast Myosin light chain 1 G3080 MLC1 YGL106W Myosin-2 light chain Calmodulin-like myosin light chain MLC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ D7508123C101E4A6 D7508123C101E4A6 myo1-mlc2-2 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1B mlc2-myo1-2 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P08964:p.Arg806Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:11:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg806ala' Tue Jun 30 19:08:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg806Ala' physical association physical association Fig. 3B As shown in Fig. 3 B, MYC-tagged Mlc2p coimmunoprecipitated effectively with GFP-tagged full-length Myo1p, Myo1p without IQ1 (IQ1Δ), and Myo1p with a point mutation at residue 806 [R806A (IQ1)] that changes the highly conserved arginine among all known type II myosins to alanine (Fig. 1 A). mlc1-myo1-1 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5A myo2-mlc1-3 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P53141:p.Gly114Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 15:35:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly114asp' Tue Jun 30 16:51:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly114Asp' P53141:p.Gly135Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G E Wed May 02 16:28:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly135glu' Tue Jun 30 15:55:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly135Glu' 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 8A iqg1-mlc1-1 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P53141:p.Gly114Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 16:34:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly114asp' Tue Jun 30 16:55:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly114Asp' P53141:p.Gly135Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G E Wed May 02 20:10:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly135glu' Tue Jun 30 15:44:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly135Glu' 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 8B myo1-mlc1-1 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P53141:p.Gly114Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 14:35:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly114asp' Tue Jun 30 17:24:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly114Asp' P53141:p.Gly135Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G E Wed May 02 20:04:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly135glu' Tue Jun 30 18:10:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly135Glu' physical association physical association Fig. 8C