IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A DAP12-mediated pathway regulates expression of CC chemokine receptor 7 and maturation of human dendritic cells. A DAP12-mediated pathway regulates expression of CC chemokine receptor 7 and maturation of human dendritic cells. The Journal of experimental medicine 2001 imex curation Bouchon A., Hernández-Munain C., Cella M., Colonna M. DSP+90? mcolonna@pathology.wustl.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bouchon A., Hernández-Munain C., Cella M., Colonna M. DSP+90? Pervanadate (phosphatase inhibitor) stimulation under reducing conditions. mcolonna@pathology.wustl.edu Accepted 2017-AUG-09 AT 17:14 BST AT 17:14 BST by PPORRAS The Journal of experimental medicine 2001 Only protein-protein interactions imex curation imex curation A DAP12-mediated pathway regulates expression of CC chemokine receptor 7 and maturation of human dendritic cells. A DAP12-mediated pathway regulates expression of CC chemokine receptor 7 and maturation of human dendritic cells. The Journal of experimental medicine 2001 imex curation Bouchon A., Hernández-Munain C., Cella M., Colonna M. DSP+90? mcolonna@pathology.wustl.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mddc Human Monocyte-derived dendritic cell monocyte-derived_dendritic_cell Monocyte-derived dendritic cell (MDDC) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bouchon A., Hernández-Munain C., Cella M., Colonna M. DSP+90? Pervanadate (phosphatase inhibitor) stimulation under reducing conditions. mcolonna@pathology.wustl.edu Accepted 2017-AUG-09 AT 17:14 BST AT 17:14 BST by PPORRAS The Journal of experimental medicine 2001 Only protein-protein interactions imex curation imex curation trem1_human Triggering receptor expressed on myeloid cells 1 TREM1 Triggering receptor expressed on monocytes 1 protein protein human Homo sapiens Human MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFNIVILLAGGFLSKSLVFSVLFAVTLRSFVP AA114696E35D4D45 trem2_human Triggering receptor expressed on myeloid cells 2 TREM2 Triggering receptor expressed on monocytes 2 protein protein human Homo sapiens Human MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT C894AA210F708AF7 tyobp_human TYRO protein tyrosine kinase-binding protein TYROBP DAP12 KARAP DNAX-activation protein 12 Killer-activating receptor-associated protein protein protein human Homo sapiens Human MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK 267CB1C1756F89F0 235rw3r-2 1 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 2C trem1-tyrobp-1 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2C