DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. Nature structural biology 2001 imex curation Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. DIP original experiment: DIP-262952X Nature structural biology 2001 IMEx A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. Nature structural biology 2001 imex curation Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. DIP original experiment: DIP-262959X Nature structural biology 2001 IMEx A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. Nature structural biology 2001 imex curation Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. DIP original experiment: DIP-262956X Nature structural biology 2001 IMEx A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. Nature structural biology 2001 imex curation Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. DIP original experiment: DIP-262955X Nature structural biology 2001 IMEx A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. Nature structural biology 2001 imex curation Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. DIP original experiment: DIP-262954X Nature structural biology 2001 IMEx A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. Nature structural biology 2001 imex curation Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. DIP original experiment: DIP-262953X Nature structural biology 2001 IMEx A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. Nature structural biology 2001 imex curation Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. DIP original experiment: DIP-262958X Nature structural biology 2001 IMEx A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. Nature structural biology 2001 imex curation Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Selleck W., Howley R., Fang Q., Podolny V., Fried MG., Buratowski S., Tan S. DIP original experiment: DIP-262957X Nature structural biology 2001 IMEx A histone fold TAF octamer within the yeast TFIID transcriptional coactivator. taf9_yeast Transcription initiation factor TFIID subunit 9 TAF9 TAF17 YMR236W YM9959.18 TBP-associated factor 9 TBP-associated factor 17 kDa TAFII-17 TAFII20 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNGGGKNVLNKNSVGSVSEVGPDSTQEETPRDVRLLHLLLASQSIHQYEDQVPLQLMDFAHRYTQGVLKDALVYNDYAGSGNSAGSGLGVEDIRLAIAARTQYQFKPTAPKELMLQLAAERNKKALPQVMGTWGVRLPPEKYCLTAKEWDLEDPKSM D1C97EDDCA468EC5 D1C97EDDCA468EC5 taf12_yeast Transcription initiation factor TFIID subunit 12 TAF12 TAF61 TAF68 YDR145W YD8358.02 TBP-associated factor 12 TBP-associated factor 61 kDa TAFII-61 TAFII-68 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNPENSGVNANNNTGTGNADAITGAQQNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRQQAAQAYNNTSNSNSSNPASIPTENVPNSSQQQQQQQQQTRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQESTQQQRVQQQRVQQQQQQQQQQQQQQQQQQQQQQQRQGQNQRKISSSNSTEIPSVTGPDALKSQQQQQNTITATNNPRGNVNTSQTEQSKAKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDKVAAAKNNGNNVASLNTKK A8FC84E46F8370D3 A8FC84E46F8370D3 taf4_yeast Transcription initiation factor TFIID subunit 4 TAF4 MPT1 TAF48 TSG2 YMR005W YM8270.07 TBP-associated factor 4 TBP-associated factor 48 kDa TAFII-48 MPT-1 TAF suppressor gene 2 protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MANSPKKPSDGTGVSASDTPKYQHTVPETKPAFNLSPGKASELSHSLPSPSQIKSTAHVSSTHNDAAGNTDDSVLPKNVSPTTNLRVESNGDTNNMFSSPAGLALPKKDDKKKNKGTSKADSKDGKASNSSGQNAQQQSDPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKIPNHLPFLHPEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRKAVKINSGRRSEVSAALRAIALIQKKEEERRVKKRIALGLEKEDYENKIDSEETLHRASNVTAGLRAGSKKQYGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMRDLLFALENRRNSVQTIISKGYAKIRD 7DFAC01C7AF07189 7DFAC01C7AF07189 taf6_yeast Transcription initiation factor TFIID subunit 6 TAF6 TAF60 YGL112C G2985 TBP-associated factor 6 TBP-associated factor 60 kDa protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTQQQSYTIWSPQDTVKDVAESLGLENINDDVLKALAMDVEYRILEIIEQAVKFKRHSKRDVLTTDDVSKALRVLNVEPLYGYYDGSEVNKAVSFSKVNTSGGQSVYYLDEEEVDFDRLINEPLPQVPRLPTFTTHWLAVEGVQPAIIQNPNLNDIRVSQPPFIRGAIVTALNDNSLQTPVTSTTASASVTDTGASQHLSNVKPGQNTEVKPLVKHVLSKELQIYFNKVISTLTAKSQADEAAQHMKQAALTSLRTDSGLHQLVPYFIQFIAEQITQNLSDLQLLTTILEMIYSLLSNTSIFLDPYIHSLMPSILTLLLAKKLGGSPKDDSPQEIHEFLERTNALRDFAASLLDYVLKKFPQAYKSLKPRVTRTLLKTFLDINRVFGTYYGCLKGVSVLEGESIRFFLGNLNNWARLVFNESGITLDNIEEHLNDDSNPTRTKFTKEETQILVDTVISALLVLKKDLPDLYEGKGEKVTDEDKEKLLERCGVTIGFHILKRDDAKELISAIFFGE 14B590E02C16F289 14B590E02C16F289 ytaf61c-ytaf48-1 1 11 unspecified role unspecified role prey prey ecolx Escherichia coli 10 unspecified role unspecified role bait bait 337-539 binding region 337-539 binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q03761:p.Leu446Ala L446A mutation mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L446A mutation'. Wed May 02 15:27:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu446ala' Tue Jun 30 17:17:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu446Ala' Q03761:p.Leu449Ala L449A mutation mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L449A mutation'. Wed May 02 15:01:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu449ala' Tue Jun 30 16:13:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu449Ala' His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ytaf17-ytaf60-1 5 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ytaf17-ytaf60-2 8 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ytaf17-ytaf60-3 4 12 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role bait bait His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ytaf48-ytaf61c-1 6 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role 337-539 binding region 337-539 binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ytaf17-ytaf48-1 2 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role 337-539 binding region 337-539 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association ytaf17-ytaf48-2 7 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role 337-539 binding region 337-539 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain Q03761:p.Leu464Ala L464A mutation mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L464A mutation'. Wed May 02 18:20:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu464ala' Tue Jun 30 17:29:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu464Ala' ecolx Escherichia coli physical association physical association ytaf48-ytaf61c-2 3 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role 337-539 binding region 337-539 binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction