DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A ubiquitin-like system mediates protein lipidation. A ubiquitin-like system mediates protein lipidation. Nature 2000 imex curation Ichimura Y., Kirisako T., Takao T., Satomi Y., Shimonishi Y., Ishihara N., Mizushima N., Tanida I., Kominami E., Ohsumi M., Noda T., Ohsumi Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ichimura Y., Kirisako T., Takao T., Satomi Y., Shimonishi Y., Ishihara N., Mizushima N., Tanida I., Kominami E., Ohsumi M., Noda T., Ohsumi Y. DIP original experiment: DIP-265102X Nature 2000 IMEx A ubiquitin-like system mediates protein lipidation. A ubiquitin-like system mediates protein lipidation. A ubiquitin-like system mediates protein lipidation. Nature 2000 imex curation Ichimura Y., Kirisako T., Takao T., Satomi Y., Shimonishi Y., Ishihara N., Mizushima N., Tanida I., Kominami E., Ohsumi M., Noda T., Ohsumi Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ichimura Y., Kirisako T., Takao T., Satomi Y., Shimonishi Y., Ishihara N., Mizushima N., Tanida I., Kominami E., Ohsumi M., Noda T., Ohsumi Y. DIP original experiment: DIP-265103X Nature 2000 IMEx A ubiquitin-like system mediates protein lipidation. A ubiquitin-like system mediates protein lipidation. A ubiquitin-like system mediates protein lipidation. Nature 2000 imex curation Ichimura Y., Kirisako T., Takao T., Satomi Y., Shimonishi Y., Ishihara N., Mizushima N., Tanida I., Kominami E., Ohsumi M., Noda T., Ohsumi Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ichimura Y., Kirisako T., Takao T., Satomi Y., Shimonishi Y., Ishihara N., Mizushima N., Tanida I., Kominami E., Ohsumi M., Noda T., Ohsumi Y. DIP original experiment: DIP-265100X Nature 2000 IMEx A ubiquitin-like system mediates protein lipidation. A ubiquitin-like system mediates protein lipidation. A ubiquitin-like system mediates protein lipidation. Nature 2000 imex curation Ichimura Y., Kirisako T., Takao T., Satomi Y., Shimonishi Y., Ishihara N., Mizushima N., Tanida I., Kominami E., Ohsumi M., Noda T., Ohsumi Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ichimura Y., Kirisako T., Takao T., Satomi Y., Shimonishi Y., Ishihara N., Mizushima N., Tanida I., Kominami E., Ohsumi M., Noda T., Ohsumi Y. DIP original experiment: DIP-265101X Nature 2000 IMEx A ubiquitin-like system mediates protein lipidation. atg7_yeast Ubiquitin-like modifier-activating enzyme ATG7 ATG7 APG7 CVT2 ATG12-activating enzyme E1 ATG7 Cytoplasm to vacuole targeting protein 2 Autophagy-related protein 7 YHR171W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQVPLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDINKCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSKWVCILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKLLIIRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRDEQSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPLYLEEISGLSVIKQEVERLGNDVFEWEDDESDEIA 561EEC94F0ED57F5 561EEC94F0ED57F5 atg3_yeast Autophagy-related protein 3 Autophagy-related E2-like conjugation enzyme ATG3 ATG3 AUT1 YNR007C N2040 APG3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIRSTLSSWREYLTPITHKSTFLTTGQITPEEFVQAGDYLCHMFPTWKWNEESSDISYRDFLPKNKQFLIIRKVPCDKRAEQCVEVEGPDVIMKGFAEDGDEDDVLEYIGSETEHVQSTPAGGTKDSSIDDIDELIQDMEIKEEDENDDTEEFNAKGGLAKDMAQERYYDLYIAYSTSYRVPKMYIVGFNSNGSPLSPEQMFEDISADYRTKTATIEKLPFYKNSVLSVSIHPCKHANVMKILLDKVRVVRQRRRKELQEEQELDGVGDWEDLQDDIDDSLRVDQYLIVFLKFITSVTPSIQHDYTMEGW 52CCFB216B18CF0C 52CCFB216B18CF0C atg8_yeast Autophagy-related protein 8 ATG8 APG8 AUT7 YBL078C YBL0732 CVT5 Autophagy-related ubiquitin-like modifier ATG8 Cytoplasm to vacuole targeting protein 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR 1246CEFF5A038819 1246CEFF5A038819 apg3p-apg8p-1 1 6 unspecified role unspecified role bait bait P40344:p.Cys234Ala C234A Mutation mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C234A Mutation'. Wed May 02 16:07:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys234ala' Tue Jun 30 18:55:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys234Ala' P40344:p.Cys234Ser C234S Mutation mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C234S Mutation'. Wed May 02 18:09:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys234ser' Tue Jun 30 20:21:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys234Ser' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey myc Tag myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association apg7p-apg8p-1 3 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait myc Tag myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association apg8p-apg7p-1 4 7 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range P38182:p.Gly116del 116 deletion mutation mutation deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain G . Wed May 02 15:18:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly116del' Tue Jun 30 19:14:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly116del' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey myc Tag myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association apg8p-apg3p-1 2 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait myc Tag myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association