DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Nature 2000 imex curation Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265095X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Nature 2000 imex curation Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265096X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Nature 2000 imex curation Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265098X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Nature 2000 imex curation Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265097X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Nature 2000 imex curation Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265099X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. p63208-1 S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 Organ of Corti protein 2 Organ of Corti protein II RNA polymerase II elongation factor-like protein SIII p19skp1 Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK DIP protein P63208-1 original sequence version: 128 DIP protein P63208-1 original sequence version: 116 DIP protein P63208 original sequence version: 76 DIP protein P63208-1 original sequence version: 76 DIP protein P63208 original sequence version: 104 DIP protein P63208 original sequence version: 127 DIP protein P63208 original sequence version: 123 DIP protein P63208 original sequence version: 61 DIP protein P63208 original sequence version: 91 DIP protein P63208 original sequence version: 115 DIP protein P63208 original sequence version: 94 DIP protein P63208 original sequence version: 75 DIP protein P63208 original sequence version: 85 C794D62AFB75528A q13309-1 S-phase kinase-associated protein 2 Cyclin-A/CDK2-associated protein p45 F-box protein Skp2 F-box/LRR-repeat protein 1 p45skp2 SKP2-alpha SKP2 FBXL1 protein protein human Homo sapiens Human MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL DIP protein Q13309-1 original sequence version: 154 DIP protein Q13309-1 original sequence version: 104 DIP protein Q13309 original sequence version: 105 DIP protein Q13309 original sequence version: 153 DIP protein Q13309 original sequence version: 151 skp1-skp2-4 1 7 unspecified role unspecified role unspecified role unspecified role 89-424 binding region 89-424 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction skp1-skp2-5 4 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role 89-424 binding region 89-424 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction skp1-skp2-6 3 6 unspecified role unspecified role unspecified role unspecified role 1-147 binding region 1-147 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role 89- 141 binding region 89- 141 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction skp1-skp2-7 2 6 unspecified role unspecified role unspecified role unspecified role 1-147 binding region 1-147 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role 89-141 binding region 89-141 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction skp2-skp1-5 5 6 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role bait bait 89-424 binding region 89-424 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction Deletion of region 148-163 decreased the interaction rate/strength.