UniProt UniProt http://www.uniprot.org Regulatory interactions between the Reg1-Glc7 protein phosphatase and the Snf1 protein kinase. Regulatory interactions between the Reg1-Glc7 protein phosphatase and the Snf1 protein kinase. Molecular and cellular biology 2000 imex curation Sanz P., Alms GR., Haystead TA., Carlson M. mbc1@columbia.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Sanz P., Alms GR., Haystead TA., Carlson M. mbc1@columbia.edu Accepted 2017-SEP-05 AT 09:12 BST AT 09:12 BST by MGT Molecular and cellular biology 2000 imex curation Regulatory interactions between the Reg1-Glc7 protein phosphatase and the Snf1 protein kinase. Regulatory interactions between the Reg1-Glc7 protein phosphatase and the Snf1 protein kinase. Molecular and cellular biology 2000 imex curation Sanz P., Alms GR., Haystead TA., Carlson M. mbc1@columbia.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sanz P., Alms GR., Haystead TA., Carlson M. mbc1@columbia.edu Accepted 2017-SEP-05 AT 09:12 BST AT 09:12 BST by MGT Molecular and cellular biology 2000 imex curation reg1_yeast Resistance to glucose repression protein 1 PZF240 SPP43 SRN1 YD9813.06C YDR028C REG1 HEX2 Protein HEX2 Second-site suppressor of the rna1-1 mutation 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTNLANYFAGKKDIENEHVNRNASHESNSKSDVKISGNDNDNDEDMGPSVSMAVQAKNDDDFHKSTFNLKRTRSMGLLDEYIDPTKKLLGRSDDLYDNDNEYYDNSSNNSSSNSSDDDYDDGYQEHSTSVSPPPADNDSYLIPQDDNDVVVEPERHVDYLSHEWKESEISNSWKYIILKKKKRDVDLVNAARLENASWRTWAKARNNLKTVSPEVVNWSKDSDVTWLYGPIVRDSEGNAQSEEEHDLERGYGSDDENSKRISMPTKNSKSIAAAPKPILKKRTVTEIIEDNALWKLNEARKHMTEMKHASVIMDPNGNKNVHDDFDALAAQVNAQYYHYPKESNSSVSLKSQHSDKKDNSTIPNPVGENSNGGGDKGEEDLHLKSALHVQNNRSTAQSNKSILENSTNDRKANLDQNLNSPDNNRFPSSTSSSNRDNENNSMGLSSILTSNPSEKSNKPTKNRHIHFNDRVEQCMALRYPASQSEDDESDDENKQYVDVNNNANVTTINNNRTPLLAIQHKSIPINSATEHLNKNTSDDDTSSQSSSSSHSDDEEHGGLYINARFSRRSDSGVHSPITDNSSVASSTTSRAHVRPIIKLLPDTTLNYGSDEESDNGEFNGYGNAVSHNVNTSRGYDYIYDYNSVYTGDTSSFLPVDSCDIVDVPEGMDLQTAIADDNASNYEFNNAVESKEKHVPQLHKASANNTTRQHGSHMLLYDDDNYSSSSDSEQQFIEDSQYNSSDDEEEEDDDDQEVDDNHDEGLSLRRTLSLGKSGSTNSLYDLAQPSLSSATPQQKNPTNFTGGKTDVDKDAQLAVRPYPLKRNSSSGNFIFNSDSEEESSSEEEQRPLPANSQLVNRSVLKGSVTPANISSQKKKALPKQPKASDSSQSFRIVNNTPSPAEVGASDVAIEGYFSPRNESIKSVVSGGNMMDHQDHSEMDTLAKGFENCHINNASKLKDKKVDSVQTTRKEASLTDSSNESLHKVVQNARGMASKYLHSWKKSDVKPQENGNDSS 0D4AAC75E111B346 0D4AAC75E111B346 pp12_yeast Serine/threonine-protein phosphatase PP1-2 GLC7 CID1 DIS2 YER133W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQKSLPRQAGGRKKK 71B20E3A4ED93235 71B20E3A4ED93235 aakg_yeast 5'-AMP-activated protein kinase subunit gamma SNF4 CAT3 Regulatory protein CAT3 SCI1 Sucrose non-fermenting protein 4 YGL115W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKPTQDSQEKVSIEQQLAVESIRKFLNSKTSYDVLPVSYRLIVLDTSLLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVIQYYFSNPDKFELVDKLQLDGLKDIERALGVDQLDTASIHPSRPLFEACLKMLESRSGRIPLIDQDEETHREIVVSVLTQYRILKFVALNCRETHFLKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQGRVSSVPIIDENGYLINVYEAYDVLGLIKGGIYNDLSLSVGEALMRRSDDFEGVYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLSDILKYILLGSN 51B387E346EE9561 51B387E346EE9561 hxkb_yeast Hexokinase-2 HKB NRB486 YGL253W HXK2 HEX1 Hexokinase-B Hexokinase PII protein protein yeast Saccharomyces cerevisiae Baker's yeast MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFISELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEPIPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRNIPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKLQGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQTFEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARIEEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGIAAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYPIKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA D55FF3F8992B2FEF D55FF3F8992B2FEF snf1_yeast Carbon catabolite-derepressing protein kinase SNF1 CAT1 CCR1 GLC2 PAS14 Sucrose nonfermentating protein 1 D8035.20 YDR477W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNNNTNTAPANANSSHHHHHHHHHHHHHGHGGSNSTLNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDLKPHPEEENENNDSKKDGSSPDNDEIDDNLVNILSSTMGYEKDEIYESLESSEDTPAFNEIRDAYMLIKENKSLIKDMKANKSVSDELDTFLSQSPPTFQQQSKSHQKSQVDHETAKQHARRMASAITQQRTYHQSPFMDQYKEEDSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDGWESSYGDDTTVSNISEDEMSTFSAYPFLHLTTKLIMELAVNSQSN F5C63565C986C4E3 F5C63565C986C4E3 snf1-reg1-1 1 3 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06782:p.Lys84Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Wed May 02 19:27:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys84arg' Tue Jun 30 18:09:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys84Arg' physical association physical association Fig. 1A Reg1 coimmunoprecipitates with the Snf1 protein kinase. snf1-reg1-2 1 3 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region lexa dna bd lexa dna binding domain lexa dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06782:p.Lys84Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Wed May 02 15:17:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys84arg' Tue Jun 30 15:53:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys84Arg' physical association physical association Fig. 1A HA-Reg1 also coimmunoprecipitated with LexA-Snf1 glc7-reg1-2 2 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait physical association physical association Fig. 2A snf1-reg1-3 2 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Fig. 2A snf1-snf4-21 2 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Overexpression of HA-Reg1 caused an almost 10-fold decrease in the interaction between SNF1 and SNF4 in low glucose, which was inhibited by a REG1 phe468arg mutation. A constitutive two-hybrid interaction between Snf1 and Snf4 in reg1-/- and hxk2-/- cells growing in 4% glucose. Figs. 3, 8 reg1-snf1-1 2 7 unspecified role unspecified role prey prey P06782:p.Lys84Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K R Wed May 02 17:17:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys84arg' Tue Jun 30 18:51:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys84Arg' 3 unspecified role unspecified role bait bait physical association physical association Fig. 7 reg1-snf1-2 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role ancillary ancillary P06782:p.Lys84Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K R Wed May 02 19:01:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys84arg' Tue Jun 30 18:00:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys84Arg' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait physical association physical association Table 1, fig 7.