UniProt UniProt http://www.uniprot.org Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD. Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD. Molecular and cellular biology 1997 imex curation Kong Y., Flick MJ., Kudla AJ., Konieczny SF. sfk@bilbo.bio.purdue.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kong Y., Flick MJ., Kudla AJ., Konieczny SF. Origin of MYOD1 accord. ref 15 (PMID 9234731), of myogenin accord. ref 20 (PMID 2473006). Origin of the vitro-translated preformed MYOD1-E47 complex according ref. 47 (PMID 7691411). Origin of Myf6/Mrf4 accord. ref. 50 (PMID 2560751) sfk@bilbo.bio.purdue.edu Accepted 2016-AUG-22 AT 11:12 BST AT 11:12 BST by MGT Molecular and cellular biology 1997 imex curation Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD. Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD. Molecular and cellular biology 1997 imex curation Kong Y., Flick MJ., Kudla AJ., Konieczny SF. sfk@bilbo.bio.purdue.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-c3h10t1_2 Mouse embryonic fibroblast C3H10T1_2 c3h10t1_2 Mouse mesenchymal stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kong Y., Flick MJ., Kudla AJ., Konieczny SF. sfk@bilbo.bio.purdue.edu Accepted 2016-AUG-22 AT 11:12 BST AT 11:12 BST by MGT Molecular and cellular biology 1997 imex curation myod1_mouse Myoblast determination protein 1 Myod1 Myod protein protein mouse Mus musculus Mouse MELLSPPLRDIDLTGPDGSLCSFETADDFYDDPCFDSPDLRFFEDLDPRLVHMGALLKPEEHAHFPTAVHPGPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAPGPLPPGRGSEHYSGDSDASSPRSNCSDGMMDYSGPPSGPRRQNGYDTAYYSEAARESRPGKSAAVSSLDCLSSIVERISTDSPAAPALLLADAPPESPPGPPEGASLSDTEQGTQTPSPDAAPQCPAGSNPNAIYQVL DIP protein P10085 original sequence version: 90 DIP protein P10085 original sequence version: 88 AEC6572277A78D54 myog_mouse Myogenin Myog MYOD1-related protein protein protein mouse Mus musculus Mouse MELYETSPYFYQEPHFYDGENYLPVHLQGFEPPGYERTELSLSPEARGPLEEKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPMVPSECNSHSASCSPEWGNALEFGPNPGDHLLAADPTDAHNLHSLTSIVDSITVEDMSVAFPDETMPN DIP protein P12979 original sequence version: 69 mint Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein CC7352C1EDF9D3D8 myf6_rat Myogenic factor 6 Muscle-specific regulatory factor 4 Myf6 Mrf4 protein protein rat Rattus norvegicus (Rat) Rat MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPQEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAINYIERLQDLLHRLDQQEKMQELGVDPYSYKPKQEILEGADFLRTCSPQWPSVSDHSRGLVITAKEGGASVDASASSSLQRLSSIVDSISSEERKLPSVEEVVEK 4EFD739BB6C4F6C5 csrp3_rat Cysteine and glycine-rich protein 3 Csrp3 Clp Mlp Cysteine-rich protein 3 LIM domain protein, cardiac Muscle LIM protein protein protein rat Rattus norvegicus (Rat) Rat MPNWGGGAKCGACDKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRKYGPKGIGFGQGAGCLSTDTGEHLGLQFQQSPKPARAATTSNPSKFSAKFGESEKCPRCGKSVYAAEKVMGGGKPWHKTCFPCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTHQVEKKE 2D6848C271BA7EAB csrp3-myod1-1 1 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro A Myod1 construct lacking the N-treminal transactivation domain also interacts. A Myod1 construct in which the basic region has been replaced by the E12 basic region does not interact 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined zinc finger, lim-type 1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 4A, B, C and D and 5 The MyoD-E47 heterodimer also retained the ability to interact with full length MLP. csrp3-myog-1 1 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 4B csrp3-myod1-2 2 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nuclear_localization_signal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6 csrp3-myf6-1 1 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 4B