UniProt UniProt http://www.uniprot.org Protein-protein interaction of zinc finger LIM domains with protein kinase C. Protein-protein interaction of zinc finger LIM domains with protein kinase C. The Journal of biological chemistry 1996 imex curation Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp Accepted 2016-DEC-07 AT 09:58 GMT AT 09:58 GMT by MGT The Journal of biological chemistry 1996 imex curation seems to be correct. thought i have seen the mutations decribed but can not find it again. i delete the mutations Protein-protein interaction of zinc finger LIM domains with protein kinase C. Protein-protein interaction of zinc finger LIM domains with protein kinase C. The Journal of biological chemistry 1996 imex curation Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp Accepted 2016-DEC-07 AT 09:58 GMT AT 09:58 GMT by MGT The Journal of biological chemistry 1996 imex curation seems to be correct. thought i have seen the mutations decribed but can not find it again. i delete the mutations Protein-protein interaction of zinc finger LIM domains with protein kinase C. Protein-protein interaction of zinc finger LIM domains with protein kinase C. The Journal of biological chemistry 1996 imex curation Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. first panel could endogenous LIMK1 (or transfected human wt), not annotated In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp Accepted 2016-DEC-07 AT 09:58 GMT AT 09:58 GMT by MGT The Journal of biological chemistry 1996 imex curation seems to be correct. thought i have seen the mutations decribed but can not find it again. i delete the mutations Protein-protein interaction of zinc finger LIM domains with protein kinase C. Protein-protein interaction of zinc finger LIM domains with protein kinase C. The Journal of biological chemistry 1996 imex curation Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp Accepted 2016-DEC-07 AT 09:58 GMT AT 09:58 GMT by MGT rat brain cDNA The Journal of biological chemistry 1996 imex curation seems to be correct. thought i have seen the mutations decribed but can not find it again. i delete the mutations Protein-protein interaction of zinc finger LIM domains with protein kinase C. Protein-protein interaction of zinc finger LIM domains with protein kinase C. The Journal of biological chemistry 1996 imex curation Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp Accepted 2016-DEC-07 AT 09:58 GMT AT 09:58 GMT by MGT The Journal of biological chemistry 1996 imex curation seems to be correct. thought i have seen the mutations decribed but can not find it again. i delete the mutations Protein-protein interaction of zinc finger LIM domains with protein kinase C. Protein-protein interaction of zinc finger LIM domains with protein kinase C. The Journal of biological chemistry 1996 imex curation Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kuroda S., Tokunaga C., Kiyohara Y., Higuchi O., Konishi H., Mizuno K., Gill GN., Kikkawa U. first panel could endogenous LIMK1 (or transfected human wt), not annotated In vitro kinase assay fig 3B omitted as purified rat cPKC is a mixture of proteins. Origin of transfected PKC constructs according PMID 3387228 and PMID 2834397. LIMK1 mutation constructs according to PMID 8183554. skuroda@inherit.biosig.kobe-u.ac.jp Accepted 2016-DEC-07 AT 09:58 GMT AT 09:58 GMT by MGT The Journal of biological chemistry 1996 imex curation seems to be correct. thought i have seen the mutations decribed but can not find it again. i delete the mutations kpcg_rat Protein kinase C gamma type Prkcg Pkcc Pkcg Prkcc protein protein rat Rattus norvegicus (Rat) Rat MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHITVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTKTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM E6E2F7A3B93042FF kpca_rat Protein kinase C alpha type Prkca Pkca protein protein rat Rattus norvegicus (Rat) Rat MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV 94889E7339C17719 kpce_rat Protein kinase C epsilon type Prkce Pkce nPKC-epsilon protein protein rat Rattus norvegicus (Rat) Rat MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLAAGAESPQPASGNSPSEDDRSKSAPTSPCDQELKELENNIRKALSFDNRGEEHRASSSTDGQLASPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSGFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHSKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVAAQNGEDAIKQHPFFKEIDWVLLEQKKMKPPFKPRIKTKRDVNNFDQDFTREEPILTLVDEAIVKQINQEEFKGFSYFGEDLMP 6AD6999EFDD2659F pdli7_human PDZ and LIM domain protein 7 LIM mineralization protein Protein enigma PDLIM7 ENIGMA protein protein human Homo sapiens Human MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFGAPPPADSAPQQNGQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV AA37F9E8E987D990 limk1_human LIM domain kinase 1 LIMK1 LIMK protein protein human Homo sapiens Human MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD DIP protein P53667 original sequence version: 113 9838BEFBE7006447 kpcz_rat Protein kinase C zeta type Prkcz Pkcz nPKC-zeta protein protein rat Rattus norvegicus (Rat) Rat MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDPTTTFQDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV DIP protein P09217 original sequence version: 107 5A3021171C2FD7C7 pdli5_rat PDZ and LIM domain protein 5 Enigma homolog Enigma-like PDZ and LIM domains protein Pdlim5 Enh protein protein rat Rattus norvegicus (Rat) Rat MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKGEPKEVVKPVPITSPAVSKVTSTTNMAYNKVPRPFGSVSSPKVTSIPSPSSAFTPAHAATSSHASPPPVAAVTPPPLSASGLHASANPSAAQCSSPPNTGKPAVHVPRQPTVTSVCSESAQELAEGQRRGSQGDIKQQNGPPRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILAQITGTEHLKESENDNAKKANSTPEPSQQSASPLSAAESLESPGSNRPVVAGLRSAAAFKPVGSTSVKSPSWQRPNQAAPSTGRISNSASSSGTGAPMKPAVGPPQPSDQDTLVQRAEHIPAGKRTPMCAHCNQAIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICRGCEFPIEAGDMFLEALGSTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF 7B26FB9BE1680299 kpcd_rat Protein kinase C delta type Prkcd Pkcd nPKC-delta protein protein rat Rattus norvegicus (Rat) Rat MAPFLRISFNSYELGSLQAEDDASQPFCAVKMKEALTTDRGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEDPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQYFLEDGDCKQSMRSEEEAMFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGTLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQKASRKPETPETVGIYQGFEKKTAVSGNDIPDNNGTYGKIWEGSNRCRLENFTFQKVLGKGSFGKVLLAELKGKERYFAIKYLKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHGKGIIYRDLKLDNVMLDKDGHIKIADFGMCKENIFGENRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPAKRLGVTGNIRLHPFFKTINWNLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQTAFKGFSFVNPKYEQFLE D2C767E55863A23C p68403-1 Protein kinase C beta type Prkcb Pkcb Prkcb1 protein protein rat Rattus norvegicus (Rat) Rat MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV A1935030F758513C prkcb-pdlim5-1 4 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure pdlim5-prkcb-1 2 13 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P68403-1:p.Lys371Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K M Wed May 02 16:26:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys371met' Tue Jun 30 18:45:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys371Met' physical association physical association 3A prkcb-pdlim5-3 2 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3A pdlim5-prkcb-2 5 13 unspecified role unspecified role bait bait zinc finger, lim-type 1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain zinc finger, lim-type 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain zinc finger, lim-type 3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A pdlim5-prkcb-3 5 13 unspecified role unspecified role prey prey zinc finger, lim-type sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4B prkce-pdlim5-1 5 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey zinc finger, lim-type sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4B pdlim7-prkcb-1 1 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined zinc finger, lim-type sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey cell lysate cell lysate n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 5A pdlim7-prkca-1 1 8 unspecified role unspecified role prey prey cell lysate cell lysate n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined zinc finger, lim-type sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association 5A pdlim7-1 1 12 unspecified role unspecified role prey prey cell lysate cell lysate n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined zinc finger, lim-type sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association 5A prkcg-limk1-1 2 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B prkcz-limk1-1 2 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B prkca-limk1-1 2 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B weak interaction prkcd-limk1-1 2 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5B weak interaction prkce-limk1-1 2 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B weak interaction prkcg-limk1-2 3 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection Mutations in the LIMK1 LIM 2 domain substituting Gly for consensus Cys residues disrupt the interaction physical association physical association 5C Three LIMK1 mutants (exact mutations not stated) were constructed , in which LIM domains were mutated not to form zinc binding by substituting Gly for consensus Cys residues. Results indicated that the LIM2 domain of LIMK1 (group B) is critical for binding. limk1-prkcg-1 6 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Mutations in the LIMK1 LIM 2 domain substituting Gly for consensus Cys residues disrupt the interaction physical association physical association 5C Three LIMK1 mutants (exact mutations not stated) were constructed , in which LIM domains were mutated not to form zinc binding by substituting Gly for consensus Cys residues. Results indicated that the LIM2 domain of LIMK1 (group B) is critical for binding.