IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. Cancer cell 2016 imex curation Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Only protein-protein interactions mouse-hsc mouse-Hepatic Stellate Cells Mouse hsc hepatic stellate cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Accepted 2017-FEB-03 AT 11:10 GMT AT 11:10 GMT by ORCHARD Cancer cell 2016 imex curation p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. Cancer cell 2016 imex curation Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Only protein-protein interactions mouse-hsc mouse-Hepatic Stellate Cells Mouse hsc hepatic stellate cell pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Accepted 2017-FEB-03 AT 11:10 GMT AT 11:10 GMT by ORCHARD Cancer cell 2016 imex curation p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. Cancer cell 2016 imex curation Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) MBP-p62 is of Human origin - see previous publication(s) pmid:9566925 mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Accepted 2017-FEB-03 AT 11:10 GMT AT 11:10 GMT by ORCHARD Cancer cell 2016 imex curation p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. Cancer cell 2016 imex curation Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) HA-p62 is of Human origin; see pmid:9566925, via links from Duran et al. 2011 et al.. mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Accepted 2017-FEB-03 AT 11:10 GMT AT 11:10 GMT by ORCHARD Cancer cell 2016 imex curation p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. p62/SQSTM1 by Binding to Vitamin D Receptor Inhibits Hepatic Stellate Cell Activity, Fibrosis, and Liver Cancer. Cancer cell 2016 imex curation Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Only protein-protein interactions mouse-hsc mouse-Hepatic Stellate Cells Mouse hsc hepatic stellate cell ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer Figs 6 J/K refer mostly to Supp Fig 5. (email sent 19/12/16 -no reply) mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Accepted 2017-FEB-03 AT 11:10 GMT AT 11:10 GMT by ORCHARD Cancer cell 2016 imex curation co1a1_mouse_gene Collagen alpha-1(I) chain Col1a1 Cola1 Alpha-1 type I collagen gene gene mouse Mus musculus Mouse sqstm_human Sequestosome-1 SQSTM1 ORCA OSIL Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa Ubiquitin-binding protein p62 EBI3-associated protein of 60 kDa protein protein human Homo sapiens Human MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL DIP protein Q13501 original sequence version: 139 DIP protein Q13501 original sequence version: 142 DIP protein Q13501 original sequence version: 163 DIP protein Q13501 original sequence version: 146 DIP protein Q13501 original sequence version: 162 DIP protein Q13501 original sequence version: 155 DIP protein Q13501 original sequence version: 140 462D94C171F337CD smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS DIP protein Q8BUN5 original sequence version: 57 46DF5E8B371321AC cp24a_mouse_gene 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial Cyp24a1 Cyp-24 Cyp24 gene gene mouse Mus musculus Mouse sqstm_mouse Sequestosome-1 Ubiquitin-binding protein p62 STONE14 Sqstm1 A170 STAP protein protein mouse Mus musculus Mouse MASFTVKAYLLGKEEATREIRRFSFCFSPEPEAEAQAAAGPGPCERLLSRVAVLFPTLRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFSHSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESASAPPEDPNVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPTTPESSSTGTEDKSNTQPSSCSSEVSKPDGAGEGPAQSLTEQMKKIALESVGQPEEQMESGNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL DIP protein Q64337 original sequence version: 121 DIP protein Q64337 original sequence version: 130 ED4CCCA7741D35CA rxra_mouse Retinoic acid receptor RXR-alpha Rxra Nr2b1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein mouse Mus musculus Mouse MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT 0AF62396BCDC87DB acta_mouse_gene Actin, aortic smooth muscle Acta2 Actsa Actvs gene gene mouse Mus musculus Mouse ncoa1_mouse Nuclear receptor coactivator 1 Ncoa1 Src1 Nuclear receptor coactivator protein 1 Steroid receptor coactivator 1 protein protein mouse Mus musculus Mouse MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPEDPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDSNSGMSIPRINPSVNPGISPAHGVTRSSTLPPSNNNMVSARVNRQQSSDLNSSSSHTNSSNNQGNFGCSPGNQIVANVALNQGQAGSQSSNPSLNLNNSPMEGTGIALSQFMSPRRQANSGLATRARMSNNSFPPNIPTLSSPVGITSGACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLSMQPAKAESKDSKEIASILNEMIQSDNSDNSANEGKPLDSGLLHNNDRLSEGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSSSASSNPSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSVPASTAVSVSGQSQGSASIKLELDAAKKKESKDHQLLRYLLDKDEKDLRSTPNLCLDDVKVKVEKKEQMDPCNTNPTPMTKPAPEEVKLESQSQFTADLDQFDQLLPTLEKAAQLPSLCETDRMDGAVTGVSIKAEVLPASLQPTTARAAPRLSRLPELELEAIDNQFGQPGAGDQIPWANNTLTTINQNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATPPLMMEDRPTLYSQPYSSPSPTAGLSGPFQGMVRQKPSLGAMPVQVTPPRGTFSPNMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQAILNQFAANAPVGMNMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQIIQQQRAMLMRHQSFGNNIPPSSGLPVQMGTPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLATRSSMVNRGMAGNMGGQFGAGISPQMQQNVFQYPGPGLVPQGEATFAPSLSPGSSMVPMPVPPPQSSLLQQTPPTSGYQSPDMKAWQQGTMGNNNVFSQAVQSQPAPAQPGVYNNMSITVSMAGGNANIQNMNPMMGQMQMSSLQMPGMNTVCSEQMNDPALRHTGLYCNQLSSTDLLKTDADGNQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE 65C08AFFCF14241D vdr_human Vitamin D3 receptor 1,25-dihydroxyvitamin D3 receptor Nuclear receptor subfamily 1 group I member 1 VDR NR1I1 protein protein human Homo sapiens Human MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS DIP protein P11473 original sequence version: 179 DIP protein P11473 original sequence version: 146 F95F300D042C4CB7 vdr_mouse Vitamin D3 receptor Vdr Nr1i1 1,25-dihydroxyvitamin D3 receptor Nuclear receptor subfamily 1 group I member 1 protein protein mouse Mus musculus Mouse MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPIRADVSTGSYSPRPTLSFSGDSSSNSDLYTPSLDMMEPASFSTMDLNEEGSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTLDDMSWDCGSQDYKYDITDVSRAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEIS DIP protein P48281 original sequence version: 89 4614DD4A129F2732 rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT DIP protein P19793 original sequence version: 177 DIP protein P19793 original sequence version: 107 DIP protein P19793 original sequence version: 153 DIP protein P19793 original sequence version: 131 DIP protein P19793 original sequence version: 136 DIP protein P19793 original sequence version: 169 DIP protein P19793 original sequence version: 161 DIP protein P19793 original sequence version: 139 7F952B580AD84C42 2t4w\rsg-1 5 9 unspecified role unspecified role prey prey proximal_promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association 5F-1 Q64337 increases the binding of P48281 to ENSMUSG00000038567 p62/Sqstm1 CHEBI:50749 increases the expression at RNA level of ENSMUSG00000038567 Fig 4E for mRNA P48281 increases expression at RNA level of ENSMUSG00000038567 CHEBI:50749 activates P48281 vdr-rxra-1 5 6 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association 5G p62/Sqstm1 Q64337 increases the binding of P48281 to ENSMUSG00000001506 vdr-col1a1-1 5 6 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association 5G-2 p62/Sqstm1 Q64337 decreases the binding of Q8BUN5 to ENSMUSG00000001506 vdr-cyp24a1-1 5 9 unspecified role unspecified role prey prey proximal_promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association 5F-2 Q64337 increases the binding of P28700 to ENSMUSG00000038567 p62/Sqstm1 vdr-col1a1-2 5 12 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association 5H p62/Sqstm1 Q64337 increases the binding of P48281 to ENSMUSG00000035783 vdr-acta2-1 5 12 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association 5H-2 p62/Sqstm1 Q64337 decreases the binding of Q8BUN5 to ENSMUSG00000035783 25235-2 1 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 6A, Supp 5F Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol rxra-sqstm1-1 1 10 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association 6B, Supp 5G Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol rxra-sqstm1-2 2 10 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6C rxra-sqstm1-3 2 10 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6C-2 Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol vdr-rxra-2 4 7 stimulator stimulator prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13501:p.Lys7Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:48:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys7ala' Tue Jun 30 19:15:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys7Ala' Q13501:p.Val188_Lys189delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain VK AA Wed May 02 14:37:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_lys188-189ala_ala' Tue Jun 30 18:07:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val188_Lys189delinsAlaAla' 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6 D/L p62 increased the formation of the heterodimer between VDR and RXRA. vdr-rxra-3 4 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6Di, Supp 5I The absence of p62 in the KO cell line reduces the interaction. 7w4ase5yty-1 3 14 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9inse 9inse 11 unspecified role unspecified role prey prey c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 6E The main text states that Fig 6E uses recombinant proteins( "....when analyzed in vitro with purified recombinant proteins (Figure 6E)"). However Flag-RXRA has been assumed to be of Murine origin (from transfected 293T cells, as used elsewhere) as NO human Flag tagged RXRA is listed on the stated supplier's web site (Active Motif). Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol p62 Q13501 increases the binding of P11473 to P28700 CHEBI:50749 increases the binding of P11473 to P28700 CHEBI:50749 and Q13501 synergistically increase the binding of P11473 to P28700 vdr-sqstm1-1 1 10 unspecified role unspecified role ancillary ancillary 11 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association 6F Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol No interaction was seen in p62KO cells. sqstm1-vdr-1 2 11 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6G Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol There appeared to be limited evidence of an interaction in the absence of Calcipotriol and/or p62. vdr-rxra-4 4 7 unspecified role unspecified role prey prey pb1_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P11473:p.[Lys246Ala;Glu420Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:06:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys246ala,glu420ala' Tue Jun 30 17:07:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys246Ala;Glu420Ala]' physical association physical association 6H, Supp5N sqstm1-vdr-2 2 13 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role ancillary ancillary proximity proximity close-contact colocalization neighbourhood interaction 6I Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol No interaction was seen in the absence of p62. vdr-rxra-5 4 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 5A sqstm1-rxra-1 4 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 5A-2 786de6-1 3 16 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp 5B CHEBI:50749 had no effect on the binding of Q13501 to P19793 CHEBI:50749 causes no change to the binding of Q13501 to P19793 these 2 causality statements are meant to state the same thing; the statement with "no effect" is new however, the other -"no change" has been used before- ?remove one? sqstm1-rxra-2 3 14 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9inse 9inse 7 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp 5 C/D Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol Supp fig 5D:the presence of free MBP reduces this interaction apparently....dont know what to make of this, so have not entered anything. (comment needed?) CHEBI:50749 decreases the binding of Q13501 to P11473 vdr-rxra-6 4 7 unspecified role unspecified role bait bait n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind range range certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13501:p.Val188_Lys189delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain VK AA Wed May 02 19:28:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_lys188-189ala_ala' Tue Jun 30 20:23:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val188_Lys189delinsAlaAla' 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 6 J, Supp 5 K/L sqstm1-rxra-3 4 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind range range range range physical association physical association Fig 6 K, Supp 5 M