IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. Biochemistry 2016 imex curation Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-mel745acl.ds19 mouse Mouse mel745acl.ds19 Mouse erythroleukemia cell line transformed by Friend virus strain 745A, clone DS19. Could not ascertain if mel75acl.19 is the same cell line, although it is very likely. Consider merging. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 Subcellular mitochondrial fractions were used in this experiment. UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu Accepted 2016-OCT-05 AT 11:30 BST AT 11:30 BST by MGT Biochemistry 2016 Only protein-protein interactions imex curation A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. Biochemistry 2016 imex curation Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 Subcellular mitochondrial fractions were used in this experiment. UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu Accepted 2016-OCT-05 AT 11:30 BST AT 11:30 BST by MGT Biochemistry 2016 Only protein-protein interactions imex curation A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. Biochemistry 2016 imex curation Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu Accepted 2016-OCT-05 AT 11:30 BST AT 11:30 BST by MGT Biochemistry 2016 Only protein-protein interactions imex curation A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. Biochemistry 2016 imex curation Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu Accepted 2016-OCT-05 AT 11:30 BST AT 11:30 BST by MGT Biochemistry 2016 Only protein-protein interactions imex curation A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase. Biochemistry 2016 imex curation Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-mel745acl.ds19 mouse Mouse mel745acl.ds19 Mouse erythroleukemia cell line transformed by Friend virus strain 745A, clone DS19. Could not ascertain if mel75acl.19 is the same cell line, although it is very likely. Consider merging. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Washing conditions Low stringency washing High stringency washing Piel RB., Shiferaw MT., Vashisht AA., Marcero JR., Praissman JL., Phillips JD., Wohlschlegel JA., Medlock AE. 27-07-2016: Submitted by A Medlock, Biomedical and Health Sciences Institute, University of Georgia. Files for this submission can be found in /sp-pro6/intact/local/data/curation-material/2016/piel-2016 Subcellular mitochondrial fractions were used in this experiment. UniProtKB identifiers were provided by the author. Enzymatic assay depicted in figure 8 was not curated because the origin of apo-CytB5 could not be ascertained. medlock@uga.edu Accepted 2016-OCT-05 AT 11:30 BST AT 11:30 BST by MGT Biochemistry 2016 Only protein-protein interactions imex curation hemh_mouse Ferrochelatase, mitochondrial Fech Protoheme ferro-lyase Heme synthase protein protein mouse Mus musculus Mouse MLSASANMAAALRAAGALLREPLVHGSSRACQPWRCQSGAAVAATTEKVHHAKTTKPQAQPERRKPKTGILMLNMGGPETLGEVQDFLQRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQERRIGGGSPIKMWTSKQGEGMVKLLDELSPATAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNEVGQKPTMKWSTIDRWPTHPLLIQCFADHILKELNHFPEEKRSEVVILFSAHSLPMSVVNRGDPYPQEVGATVHKVMEKLGYPNPYRLVWQSKVGPVPWLGPQTDEAIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAQKCGAENIRRAESLNGNPLFSKALADLVHSHIQSNKLCSTQLSLNCPLCVNPVCRKTKSFFTSQQL Catalyzes the ferrous insertion into protoporphyrin IX mint Defects in Fech are the cause of a viable autosomal recessive mutation (named Fechm1Pas or Fch) that causes jaundice and anemia 9BC4DBD18727105A sucb1_mouse Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial ATP-specific succinyl-CoA synthetase subunit beta Succinyl-CoA synthetase beta-A chain Sucla2 protein protein mouse Mus musculus Mouse MAASMFYGRQLAAAALRSHRPQTTLRAAAQVLGNSGLFNKHGLQVQQQQQRTLSLHEYLSMELLQEAGVSVPKGFVAKSSDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFTSGLKGGVKIVFSPEEAKAVSSQMIGQKLITKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSAQGGVNIEDVAAENPEAIVKEPIDIVEGIKKEQAVTLAQKMGFPSNIVDSAAENMIKLYNLFLKYDATMVEINPMVEDSDGKVLCMDAKINFDSNSAYRQKKIFDLQDWSQEDERDKEAANADINYIGLDGSIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVQQVTEAFKLITSDKKVQAILVNIFGGIMRCDVIAQGIVMAVKDLEIRIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAAKMVVKLSEIVTLAKEAHVDVKFQLPI 74CE8E962BC0BB27 opa1_mouse Dynamin-like 120 kDa protein, mitochondrial Optic atrophy protein 1 homolog Large GTP-binding protein Opa1 protein protein mouse Mus musculus Mouse MWRAGRAAVACEVCQSLVKHSSGIQRNVPLQKLHLVSRSIYRSHHPALKLQRPQLRTPFQQFSSLTHLSLHKLKLSPIKYGYQPRRNFWPARLAARLLKLRYIILGSAVGGGYTAKKTFDEWKDMIPDLSDYKWIVPDFIWEIDEYIDLEKIRKALPSSEDLASLAPDLDKITESLSLLKDFFTAGSPGETAFRATDHGSESDKHYRKVSDKEKIDQLQEELLHTQLKYQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQGRLKDTENAIENMIGPDWKKRWMYWKNRTQEQCVHNETKNELEKMLKVNDEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCNLCRRGFYYYQRHFIDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKVKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK 0F103FB1FD570F49 hemh_human Ferrochelatase, mitochondrial Protoheme ferro-lyase Heme synthase FECH protein protein human Homo sapiens Human MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL DIP protein P22830 original sequence version: 155 3FD50965E8DEABCE pgrc1_mouse Membrane-associated progesterone receptor component 1 Pgrmc1 Pgrmc protein protein mouse Mus musculus Mouse MAAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDETARKNE 1FFD17AFAE6C81FC mic60_mouse MICOS complex subunit Mic60 Mitofilin Immt Mic60 Mitochondrial inner membrane protein protein protein mouse Mus musculus Mouse MLRACQLSGVTVAAQSCLCGKFVLRPLRPCRRYSTSSSSGLTAGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFGMVLGSAPYTVPLPKKPVQSGPLKISSVSEVMKDSKLPVAQSQKTKGDTPASAASTGAAQIISAAGDTLSVPAPAVQHEDTIKTECPNTNEGKSTSETTEEAFSSSVRERPPEEVAARLAQQEKQEQVEMESLAKSLEDALNRTSSVTLQTITAQNAAVQAVKAHSNILKTAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKEELEKMKTIIEDAKKREIAGATPHITAAEGRLHNMIVDLDNVVKKVQAAQSEAKVVSQYHELVVQARDDFRKELDSITPDITPGWKGMSISDLAGKLSTDDLNSLIAHAHRRIDQLNRELAQQKATEKQHIELALEKHKLEEKRTFDSAVAKALEHHRSEIQAEQDRKVEEVRDAMENEMRTQLRRQAAAHTDHLRDVLKVQEQELKYEFEQGLSEKLSEQELEFRRRSQEQMDSFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAEMPTIPLGSAVEAIRVNCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFLSYLQSLLLFPPKQLKPPAELYPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQQE DIP protein Q8CAQ8 original sequence version: 73 5EB37BCA054BD7A6 pgrc2_mouse Membrane-associated progesterone receptor component 2 Pgrmc2 protein protein mouse Mus musculus Mouse MAAGDGDVKLSTLGSGGESGGDGSPGGAGATAARSSWVAALLATGGEMLLNVALVALVLLGAYRLWVRWGRRGLCSGPGAGEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHSKQD 0291B0EFE8AD3403 mic27_mouse MICOS complex subunit Mic27 Apolipoprotein O-like Protein FAM121A Apool Fam121a Mic27 protein protein mouse Mus musculus Mouse MAAFRMGKLTTIPAGLIYASINVRLAKEEEPKKQLVRPDQLPIYTAPPLHSKYVEEQPGNLQRGFASIRTTTVYYIGWCKSIYLFMKNGVMDTVQFGKDAYVYLKNPPQDFLPKMGVITASGLAGLLSARKGSRFKKIAYPLGLATLGATVCYPAQSVIIAKITGKKAYATSQQIFQAIKSLWTQKSENESLPEPKEESKEGRSDEIHASLPDLKHSVSLPKELASATVIKSESTSGTTQFIPDPKLMDHGQSHPDDKDMYSTRS 3DBAFD5D0AA3DC78 adt2_mouse ADP/ATP translocase 2 Adenine nucleotide translocator 2 ADP,ATP carrier protein 2 Solute carrier family 25 member 5 Slc25a5 Ant2 Aac2 protein protein mouse Mus musculus Mouse MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT DIP protein P51881 original sequence version: 108 0798E04B987EFE20 tfr1_mouse Transferrin receptor protein 1 Tfrc Trfr protein protein mouse Mus musculus Mouse MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAADEEENADNNMKASVRKPKRFNGRLCFAAIALVIFFLIGFMSGYLGYCKRVEQKEECVKLAETEETDKSETMETEDVPTSSRLYWADLKTLLSEKLNSIEFADTIKQLSQNTYTPREAGSQKDESLAYYIENQFHEFKFSKVWRDEHYVKIQVKSSIGQNMVTIVQSNGNLDPVESPEGYVAFSKPTEVSGKLVHANFGTKKDFEELSYSVNGSLVIVRAGEITFAEKVANAQSFNAIGVLIYMDKNKFPVVEADLALFGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISRAAAEKLFGKMEGSCPARWNIDSSCKLELSQNQNVKLIVKNVLKERRILNIFGVIKGYEEPDRYVVVGAQRDALGAGVAAKSSVGTGLLLKLAQVFSDMISKDGFRPSRSIIFASWTAGDFGAVGATEWLEGYLSSLHLKAFTYINLDKVVLGTSNFKVSASPLLYTLMGKIMQDVKHPVDGKSLYRDSNWISKVEKLSFDNAAYPFLAYSGIPAVSFCFCEDADYPYLGTRLDTYEALTQKVPQLNQMVRTAAEVAGQLIIKLTHDVELNLDYEMYNSKLLSFMKDLNQFKTDIRDMGLSLQWLYSARGDYFRATSRLTTDFHNAEKTNRFVMREINDRIMKVEYHFLSPYVSPRESPFRHIFWGSGSHTLSALVENLKLRQKNITAFNETLFRNQLALATWTIQGVANALSGDIWNIDNEF adt1_mouse ADP/ATP translocase 1 Slc25a4 Anc1 Ant1 Adenine nucleotide translocator 1 ADP,ATP carrier protein 1 Solute carrier family 25 member 4 ADP,ATP carrier protein, heart/skeletal muscle isoform T1 Aac1 protein protein mouse Mus musculus Mouse MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV 3A849FEAB0981462 abcb7_mouse Iron-sulfur clusters transporter ABCB7, mitochondrial Abcb7 Abc7 ATP-binding cassette transporter 7 ATP-binding cassette sub-family B member 7, mitochondrial protein protein mouse Mus musculus Mouse MALLAIHSWRWAAAAVAFEKHKHSAVLTRALVSMCGSGPRWSSSQRGASGSARLSQTTESLRNTTQQRWGKDNSRQLLDATKALQTWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPEDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATMATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIVFEMMLVSSVLYYKCGAQFALVTLGTLGAYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNEKYEAQRYDGFLKTYETASLKSTSTLAMLNFGQNAIFSVGLTAIMVLASQGIVAGALTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTRIKDKVMAPPLQITPQTATVAFDNVHFEYIEGQKVLNGVSFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNLQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNINASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKNPPVILYDEATSSLDSITEETILGAMRDVVKHRTSIFIAHRLSTVVDADEIIVLSQGKVAERGTHYGLLANSSSIYSEMWHTQSNRVQNQDSLGWDAKKESLSKEEERKKLQEEIVNSVKGCGNCSC 79B2BC8A7A07555A abcba_mouse ATP-binding cassette sub-family B member 10, mitochondrial ABC-mitochondrial erythroid protein ATP-binding cassette transporter 10 Abcb10 protein protein mouse Mus musculus Mouse MRAPSARALLLIPRRGPAVRAWAPAVSSRIWLASEWTPLVRAWTSLIHKPGSGLRFPAPLSGLPGGVGQWATSSGARRCWVLAGPRAAHPLFARLQGAAATGVRDLGNDSQRRPAATGRSEVWKLLGLVRPERGRLSAAVGFLAVSSVITMSAPFFLGRIIDVIYTNPSEGYGDSLTRLCAVLTCVFLCGAAANGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGVGMMFFVSPSLATFVLSVVPPISVLAVIYGRYLRKLSKATQDSLAEATQLAEERIGNIRTIRAFGKEMTEVEKYTGRVDQLLQLAQKEALARAGFFGAAGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGLSIGGLSSFYSELMKGLGAGGRLWELLERQPRLPFNEGMVLDEKTFQGALEFRNVHFTYPARPEVSVFQDFSLSIPSGSVTALVGPSGSGKSTVVSLLLRLYDPNSGTVSLDGHDIRQLNPVWLRSKIGTVSQEPVLFSCSVAENIAYGADNLSSVTAQQVERAAEVANAAEFIRSFPQGFDTVVGEKGILLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEHLVQEALDRLMEGRTVLIIAHRLSTIKNANFVAVLDHGKICEHGTHEELLLKPNGLYRKLMNKQSFLSYNGAEQFLEPARA C07BE44A478B89A2 ppox_mouse Protoporphyrinogen oxidase Ppox protein protein mouse Mus musculus Mouse MGRTVIVLGGGISGLAASYHLIRGPSPPKVILVEGSKRLGGWIRSIRGSDGAIFELGPRGIRPAGALGARTLLLVSELGLESEVLPVRGDHPAAQNRFLYVGGTLHPLPSGLRGLLRPSPPFSKPLFWAGLRELLKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSIRSCFPSLFQAEQTHRSILLGLLLGAGQSPQPDSSLIRQARAERWSQWSLRGGLEVLPQALHNHLASKGVTVLSGQPVCGLSLQPEGRWKVSLGDSSLEADHIISAIPASELSKLLPAEAAPLARILSTIKAVSVAVVNLQYRGACLPVQGFGHLVPSSEDPTVLGIVYDSVAFPEQDGNPPSLRVTVMLGGYWLQKLKAAGHQLSPELFQQQAQEAAATQLGLKEPPSHCLVHLHKNCIPQYTIGHWQKLDSAMQFLTAQRLPLTLAGASYEGVAVNDCIESGRQAAVAVLGTESNS 8CFB48120728DE6F stea3_mouse Metalloreductase STEAP3 Dudulin-2 Protein nm1054 Six-transmembrane epithelial antigen of prostate 3 Tumor suppressor-activated pathway protein 6 Steap3 Tsap6 protein protein mouse Mus musculus Mouse MSGEMDKPLISRRLVDSDGSLAEVPKEAPKVGILGSGDFARSLATRLVGSGFSVVVGSRNPKRTAGLFPSLAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLADQLAGKILVDVSNPTEKEHLQHRQSNAEYLASLFPACTVVKAFNVISAWALQAGPRDGNRQVLICSDQPEAKRTISEMARAMGFTPLDMGSLASAREVEAIPLRLLPSWKVPTLLALGLFVCFYTYNFIRDVLQPYIRKDENKFYKMPLSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFFAMLHALYSFCLPLRRSHRYDLVNLAVKQVLANKSRLWVEEEVWRMEIYLSLGVLALGMLSLLAVTSLPSIANSLNWKEFSFVQSTLGFVALILSTMHTLTYGWTRAFEENHYKFYLPPTFTLTLLLPCVIILAKGLFLLPCLSRRLTKIRRGWEKDGAVKFMLPGDHTQGEKTSHV 9A08D99C90CF83F4 pgrc2_human Membrane-associated progesterone receptor component 2 Progesterone membrane-binding protein Steroid receptor protein DG6 PGRMC2 DG6 PMBP protein protein human Homo sapiens Human MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD BE36229EDF0FF3AD pgrc1_human Membrane-associated progesterone receptor component 1 Dap1 IZA PGRMC1 HPR6.6 PGRMC protein protein human Homo sapiens Human MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND CCD5E802E1C9E604 hem0_mouse 5-aminolevulinate synthase, erythroid-specific, mitochondrial 5-aminolevulinic acid synthase 2 Delta-ALA synthase 2 Delta-aminolevulinate synthase 2 Alas2 protein protein mouse Mus musculus Mouse MVAAAMLLRSCPVLSQGPTGLLGKVAKTYQFLFSIGRCPILATQGPTCSQIHLKATKAGGDSPSWAKSHCPFMLSELQDRKSKIVQRAAPEVQEDVKTFKTDLLSTMDSTTRSHSFPSFQEPEQTEGAVPHLIQNNMTGSQAFGYDQFFRDKIMEKKQDHTYRVFKTVNRWANAYPFAQHFSEASMASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVHAVGLYGARGAGIGERDGIMHKLDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGFPVIPCPSHIIPIRVGNAALNSKICDLLLSKHSIYVQAINYPTVPRGEELLRLAPSPHHSPQMMENFVEKLLLAWTEVGLPLQDVSVAACNFCHRPVHFELMSEWERSYFGNMGPQYVTTYA A878D79FAD5B9856 mesoporphyrin ix mesoporphyrin IX small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) m2om_mouse Mitochondrial 2-oxoglutarate/malate carrier protein Slc25a11 Solute carrier family 25 member 11 protein protein mouse Mus musculus Mouse MAATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKTEGLKGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALVRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG 1B19A5DB093941A3 vdac2_mouse Voltage-dependent anion-selective channel protein 2 Voltage-dependent anion-selective channel protein 6 Outer mitochondrial membrane protein porin 2 Vdac2 Vdac6 protein protein mouse Mus musculus Mouse MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELEA 7BBCDC625AD013C7 fech-2 5 fech 8 unspecified role unspecified role prey prey Apool 15 unspecified role unspecified role prey prey FECH 11 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range opa1 10 unspecified role unspecified role prey prey Immt Apool 13 unspecified role unspecified role prey prey pgrmc2 14 unspecified role unspecified role prey prey pgrmc1 12 unspecified role unspecified role prey prey association association 6 Table 1, fig 1 pgrmc1-1 5 fech 8 unspecified role unspecified role prey prey Metalloreductase steap3 (steap3) 22 unspecified role unspecified role prey prey transferrin receptor protein 1 (tfrc) 17 unspecified role unspecified role prey prey 2-oxoglutarate/malate carrier slc25a11 (ocg) 27 unspecified role unspecified role prey prey voltage dependent anion selective protein channel 2 (vdac-2) 28 unspecified role unspecified role prey prey ADP/ATP translocase 2 slc25a5 (ant2) 16 unspecified role unspecified role prey prey ADP/ATP translocase 1 slc25a4 (ant1) 18 unspecified role unspecified role prey prey abcb7 19 unspecified role unspecified role prey prey abcb10 20 unspecified role unspecified role prey prey sucla2 9 unspecified role unspecified role prey prey alas-2 25 unspecified role unspecified role prey prey ppox 21 unspecified role unspecified role prey prey opa1 10 unspecified role unspecified role prey prey Immt 13 unspecified role unspecified role prey prey pgrmc2 14 unspecified role unspecified role prey prey pgrmc1 12 unspecified role unspecified role prey prey Apool 15 unspecified role unspecified role prey prey PGRMC1 24 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 6 Table 1, suppl. table 1, fig. 1 pgrmc1-abcb10-1 5 fech 8 unspecified role unspecified role prey prey Apool 15 unspecified role unspecified role prey prey Metalloreductase steap3 (steap3) 22 unspecified role unspecified role prey prey transferrin receptor protein 1 (tfrc) 17 unspecified role unspecified role prey prey 2-oxoglutarate/malate carrier slc25a11 (ocg) 27 unspecified role unspecified role prey prey voltage dependent anion selective protein channel 2 (vdac-2) 28 unspecified role unspecified role prey prey ADP/ATP translocase 2 slc25a5 (ant2) 16 unspecified role unspecified role prey prey ADP/ATP translocase 1 slc25a4 (ant1) 18 unspecified role unspecified role prey prey abcb7 19 unspecified role unspecified role prey prey abcb10 20 unspecified role unspecified role prey prey sucla2 9 unspecified role unspecified role prey prey alas-2 25 unspecified role unspecified role prey prey opa1 10 unspecified role unspecified role prey prey Immt 13 unspecified role unspecified role prey prey pgrmc2 14 unspecified role unspecified role prey prey pgrmc1 12 unspecified role unspecified role prey prey PGRMC2 23 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 6 Table 1, suppl. table 1, fig. 1 fech-fech-1 1 fech 8 unspecified role unspecified role prey prey immt 13 unspecified role unspecified role prey prey ppox 21 unspecified role unspecified role prey prey sucla2 9 unspecified role unspecified role prey prey FECH 11 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range abcb10 20 unspecified role unspecified role prey prey abcb7 19 unspecified role unspecified role prey prey pgrmc2 14 unspecified role unspecified role prey prey pgrmc1 12 unspecified role unspecified role prey prey association association 2A abcb10-2 1 fech 8 unspecified role unspecified role prey prey immt 13 unspecified role unspecified role prey prey ppox 21 unspecified role unspecified role prey prey sucla2 9 unspecified role unspecified role prey prey abcb10 20 unspecified role unspecified role prey prey abcb7 19 unspecified role unspecified role prey prey pgrmc2 14 unspecified role unspecified role prey prey pgrmc1 12 unspecified role unspecified role prey prey PGRMC1 24 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 2A fech-pgrmc1-1 2 24 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2B fech-fech-2 5 fech 8 unspecified role unspecified role prey prey FECH 11 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range pgrmc2 14 unspecified role unspecified role prey prey pgrmc1 12 unspecified role unspecified role prey prey association association 7 Table S2 fech-fech-3 5 fech 8 unspecified role unspecified role prey prey PGRMC1 24 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range pgrmc1 12 unspecified role unspecified role prey prey association association 7 Table S2 pgrmc1-fech-1 5 fech 8 unspecified role unspecified role prey prey PGRMC2 23 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 7 Table S2 fech-pgrmc1-2 3 PGRMC1 24 unspecified role unspecified role prey prey cell lysate cell lysate ecoli Escherichia coli (strain K12) FECH 11 unspecified role unspecified role bait bait cell lysate cell lysate n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P22830:p.Phe110Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain F A Wed May 02 18:22:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe110ala' Tue Jun 30 20:02:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe110Ala' P22830:p.Glu343Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E K Wed May 02 15:03:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu343lys' Tue Jun 30 20:09:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu343Lys' ecoli Escherichia coli (strain K12) physical association physical association 3A,3B fech-pgrmc1-3 4 26 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 24 inhibitor inhibitor neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 11 enzyme enzyme neutral component neutral component purified purified P22830:p.Phe110Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F A Wed May 02 18:01:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe110ala' Tue Jun 30 18:55:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe110Ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 9 In the presence of PGRMC1 the activity of the F110A variant showed a level of inhibition slightly higher than that of the WT enzyme. fech-pgrmc1-4 4 26 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 11 enzyme enzyme neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P22830:p.Phe110Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:31:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe110ala' Tue Jun 30 18:30:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe110Ala' ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 9i