IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Nature communications 2015 imex curation Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu Accepted 2017-SEP-13 AT 12:07 BST AT 12:07 BST by PPORRAS Human substantia nigra library in pPC86 vector Nature communications 2015 imex curation I have altered short label of the mutation, and range to "?-?". - both mutations are mentioned in Ref 48. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Nature communications 2015 imex curation Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. transgenic mice LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu Accepted 2017-SEP-13 AT 12:07 BST AT 12:07 BST by PPORRAS Nature communications 2015 imex curation I have altered short label of the mutation, and range to "?-?". - both mutations are mentioned in Ref 48. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Nature communications 2015 imex curation Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu Accepted 2017-SEP-13 AT 12:07 BST AT 12:07 BST by PPORRAS Nature communications 2015 imex curation I have altered short label of the mutation, and range to "?-?". - both mutations are mentioned in Ref 48. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Nature communications 2015 imex curation Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Figure IE has been assumed to have been carried out using 293 cells - the same as figs 1A/B, but no cell line is given in this publication and the authors did not reply to a request to clarify. LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu Accepted 2017-SEP-13 AT 12:07 BST AT 12:07 BST by PPORRAS Nature communications 2015 imex curation I have altered short label of the mutation, and range to "?-?". - both mutations are mentioned in Ref 48. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Nature communications 2015 imex curation Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-brain Homo sapiens brain brain Brain [cerebrum] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Post-mortem tissue from Parkinson's Disease patients taken from the substantia nigra. LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu Accepted 2017-SEP-13 AT 12:07 BST AT 12:07 BST by PPORRAS Nature communications 2015 imex curation I have altered short label of the mutation, and range to "?-?". - both mutations are mentioned in Ref 48. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Ubiqutination via K27 and K29 chains signals aggregation and neuronal protection of LRRK2 by WSB1. Nature communications 2015 imex curation Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Nucifora FC., Nucifora LG., Ng CH., Arbez N., Guo Y., Roby E., Shani V., Engelender S., Wei D., Wang XF., Li T., Moore DJ., Pletnikova O., Troncoso JC., Sawa A., Dawson TM., Smith W., Lim KL., Ross CA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. LRRK2 was determined to be of Human origin from Reference 34. Myc-tagged WSB1 is of human origin - from Ref 36. nucifora@jhmi.edu Accepted 2017-SEP-13 AT 12:07 BST AT 12:07 BST by PPORRAS Nature communications 2015 imex curation I have altered short label of the mutation, and range to "?-?". - both mutations are mentioned in Ref 48. lrrk2_mouse Leucine-rich repeat serine/threonine-protein kinase 2 Lrrk2 protein protein mouse Mus musculus Mouse MASGACQGCEEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDMLVFTYSDRASKLFEDKNFHVPLLIVLDSYMRVASVQQAGWSLLCKLIEVCPGTLQSLIGPQDIGNDWEVLGIHRLILKMLTVHHANVNLSIVGLKALDLLLDSGKLTLLILDEECDIFLLIFDAMHRYSANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYTILLSTFGSFRRDKEIVYHVLCCLHSLAVTCSNVEVLMSGNVRCYNLVVEAMKAFPTNENIQEVSCSLFQKLTLGNFFNILVLNEVHVFVVKAVRQYPENAALQISALSCLALLTETIFLNQDLEERSETQEQSEEEDSEKLFWLEPCYKALVRHRKDKHVQEAACWALNNLLMYQNSLHEKIGDEDGQFPAHREVMLSMLMHSSSKDVFQAAAHALSTLLEQNVNFRKILLAKGVYLNVLELMQKHAHAPEVAESGCKMLSHLFEGSNPSLDTMAAVVPKILTVMKAHGTSLSVQLEALRAILHFVVPGLLEESREDSQCRPNVLRKQCFRTDIHKLVLVALNRFIGNPGIQKCGLKVISSLAHLPDATETLSLQGAVDSVLHTLQMYPDDQEIQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTLQRFKDVAEVQTTGLQTTLSILELSVSFSKLLVHYSFDVVIFHQMSSSVVEQKDEQFLNLCCKCFAKVAVDDELKNTMLERACDQNNSIMVECLLLLGADANQVKGATSLIYQVCEKESSPKLVELLLNGGCREQDVRKALTVSIQKGDSQVISLLLRKLALDLANNSICLGGFGIGKIDPSWLGPLFPDKSSNLRKQTNTGSVLARKVLRYQMRNTLQEGVASGSDGKFSEDALAKFGEWTFIPDSSMDSVFGQSDDLDSEGSESSFLVKRKSNSISVGEVYRDLALQRCSPNAQRHSNSLGPVFDHEDLLRRKRKILSSDESLRSSRLPSHMRQSDSSSSLASEREHITSLDLSANELKDIDALSQKCCLSSHLEHLTKLELHQNSLTSFPQQLCETLKCLIHLDLHSNKFTSFPSFVLKMPRITNLDASRNDIGPTVVLDPAMKCPSLKQLNLSYNQLSSIPENLAQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNHIPSLPGDFLEACSKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRSLDMSHNNIECLPGPAHWKSLNLRELIFSKNQISTLDFSENPHVWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKPELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEHQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLHDIWTTGSRIMEGLRFPNEFDELAIQGKLPDPVKEYGCAPWPMVEKLITKCLKENPQERPTSAQVFDILNSAELICLMRHILIPKNIIVECMVATNLNSKSATLWLGCGNTEKGQLSLFDLNTERYSYEEVADSRILCLALVHLAAEKESWVVCGTQSGALLVINVEEETKRHTLEKMTDSVTCLHCNSLAKQSKQSNFLLVGTADGNLMIFEDKAVKCKGAAPLKTLHIGDVSTPLMCLSESLNSSERHITWGGCGTKVFSFSNDFTIQKLIETKTNQLFSYAAFSDSNIIALAVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKLNKESKHQLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMATAQLGSLKNVMLVLGYKRKSTEGIQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADKMRKTSVE DIP protein Q5S006 original sequence version: 57 706E25C173E36F98 wsb1_human WD repeat and SOCS box-containing protein 1 SOCS box-containing WD protein SWiP-1 WSB1 SWIP1 protein protein human Homo sapiens Human MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYRI 650D4942E97D4BED lrrk2_human Leucine-rich repeat serine/threonine-protein kinase 2 LRRK2 PARK8 Dardarin protein protein human Homo sapiens Human MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE DIP protein Q5S007 original sequence version: 36 DIP protein Q5S007 original sequence version: 68 DIP protein Q5S007 original sequence version: 64 26142A0CECBBC3F4 wsb1_mouse WD repeat and SOCS box-containing protein 1 Wsb1 protein protein mouse Mus musculus Mouse MASFPPRVNEKEIVRSRTIGELLAPAAPFDKKCGGENWTVAFAPDGSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPPEHVIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHIEMVRDLTFAPDGSLLLVSASRDKTLRVWDLKDDGNMVKVLRAHQNWVYSCAFSPDCSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYVWDPHNGDLLMEFGHLFPSPTPIFAGGANDRWVRAVSFSHDGLHVASLADDKMVRFWRIDEDCPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHICRMSIRRVMSTQEVQKLPVPSKILAFLSYRG 4003D1FFE7A9A2EF lrrk2-wsb1-1 4 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q5S007:p.Gly2019Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G S Wed May 02 17:00:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly2019ser' Tue Jun 30 17:56:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly2019Ser' physical association physical association 1A lrrk2-wsb1-3 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait kinase_domain sufficient to bind sufficient binding region sufficient to bind range range range range undefined mutation mutation mutation undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Inactivating mutation, possibly asp1994asn or asp_tyr2017-2018ala_leu. physical association physical association no figure The authors state that "A construct containing the kinase domain of LRRK2 with a point mutation to inactivate kinase activity" was used; however the exact mutation is not described. Ref 48 gives the D1994N point mutation but also another inactivating mutation:- asp_tyr2017-2018ala_leu. 346et-1 3 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1C lrrk2-wsb1-4 2 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1D wsb1-lrrk2-1 4 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined wd_repeats required to bind necessary binding region required to bind range range range range 9 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q5S007:p.Gly2019Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G S Wed May 02 19:34:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly2019ser' Tue Jun 30 17:14:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly2019Ser' physical association physical association 1 B/E lrrk2-wsb1-5 6 9 unspecified role unspecified role neutral component neutral component Q5S007:p.Gly2019Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G S Wed May 02 14:31:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly2019ser' Tue Jun 30 16:55:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly2019Ser' 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 5K Proteins co-localized in aggregate structures 7sdiyrfjhv-1 5 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 8C WSB1 also co-localizes with alpha-synuclein and ubiquitin in Lewy bodies and neurites.