MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Activation of the cAMP/protein kinase A signalling pathway by coronin 1 is regulated by cyclin-dependent kinase 5 activity. Activation of the cAMP/protein kinase A signalling pathway by coronin 1 is regulated by cyclin-dependent kinase 5 activity. FEBS letters 2016 imex curation Liu X., BoseDasgupta S., Jayachandran R., Studer V., Rühl S., Stiess M., Pieters J. jean.pieters@unibas.ch 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study autoradiography autoradiography Liu X., BoseDasgupta S., Jayachandran R., Studer V., Rühl S., Stiess M., Pieters J. jean.pieters@unibas.ch Accepted 2016-MAR-09 AT 08:36 GMT AT 08:36 GMT by MARTA FEBS letters 2016 Only protein-protein interactions imex curation imex curation Activation of the cAMP/protein kinase A signalling pathway by coronin 1 is regulated by cyclin-dependent kinase 5 activity. Activation of the cAMP/protein kinase A signalling pathway by coronin 1 is regulated by cyclin-dependent kinase 5 activity. FEBS letters 2016 imex curation Liu X., BoseDasgupta S., Jayachandran R., Studer V., Rühl S., Stiess M., Pieters J. jean.pieters@unibas.ch 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., BoseDasgupta S., Jayachandran R., Studer V., Rühl S., Stiess M., Pieters J. jean.pieters@unibas.ch Accepted 2016-MAR-09 AT 08:36 GMT AT 08:36 GMT by MARTA FEBS letters 2016 Only protein-protein interactions imex curation imex curation cor1a_mouse Coronin-1A Coro1a Coro1 Coronin-like protein A Coronin-like protein p57 Tryptophan aspartate-containing coat protein protein protein mouse Mus musculus Mouse MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPLGKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKDRPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDSARRRATPEPSGTPSSDTVSRLEEDVRNLNAIVQKLQERLDRLEETVQAK 9098F53757C5318D gnas2_human Guanine nucleotide-binding protein G(s) subunit alpha isoforms short Adenylate cyclase-stimulating G alpha protein GNAS GNAS1 GSP protein protein human Homo sapiens Human MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL CD541181FC4412EF cd5r1_human Cyclin-dependent kinase 5 activator 1 Cyclin-dependent kinase 5 regulatory subunit 1 TPKII regulatory subunit CDK5R1 CDK5R NCK5A protein protein human Homo sapiens Human MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR DIP protein Q15078 original sequence version: 119 DIP protein Q15078 original sequence version: 130 DIP protein Q15078 original sequence version: 109 D1C29A07AFF1B644 cdk5r1-coro1a-1 1 5 predetermined predetermined participant predetermined autoradiography autoradiography enzyme enzyme neutral component neutral component purified purified 3 enzyme target enzyme target substrate substrate neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation f1b coro1a-1 2 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell O89053:p.Thr418Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:32:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr418ala' Tue Jun 30 19:35:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr418Ala' O89053:p.Thr424Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:27:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr424ala' Tue Jun 30 17:36:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr424Ala' O89053:p.[Thr418Ala;Thr424Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A Fri Jul 22 10:52:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr418ala_thr424ala' Wed May 02 17:49:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr418ala,thr424ala' Tue Jun 30 19:12:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr418Ala;Thr424Ala]' 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f2c gnas-coro1a-1 2 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:06:05 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'thr418ala' undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:06:03 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'thr424ala' O89053:p.[Thr418Glu;Thr424Glu] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain T E Fri Jul 22 11:05:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr418ala_thr424glu' Wed May 02 17:59:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr418glu,thr424glu' Tue Jun 30 16:20:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr418Glu;Thr424Glu]' 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3a