IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions. SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions. Biochimica et biophysica acta 2016 imex curation Carlsson E., Ding JL., Byrne B. emails snt 5/5 for species of GST-MAL and TRAM. Dark space = no 20? Table S1 primers are all of Human origin;determined by Blat. The authors have stated that GST-MAL and TRAM are of Human origin. e.carlsson11@imperial.ac.uk,dbsdjl@nus.edu.sg, b.byrne@imperial.ac.uk 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Carlsson E., Ding JL., Byrne B. emails snt 5/5 for species of GST-MAL and TRAM. Table S1 primers are all of Human origin;determined by Blat. The authors have stated that GST-MAL and TRAM are of Human origin. e.carlsson11@imperial.ac.uk,dbsdjl@nus.edu.sg, b.byrne@imperial.ac.uk Accepted 2016-MAY-13 AT 15:10 BST AT 15:10 BST by ORCHARD Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation imex curation SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions. SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions. Biochimica et biophysica acta 2016 imex curation Carlsson E., Ding JL., Byrne B. emails snt 5/5 for species of GST-MAL and TRAM. Dark space = no 20? Table S1 primers are all of Human origin;determined by Blat. The authors have stated that GST-MAL and TRAM are of Human origin. e.carlsson11@imperial.ac.uk,dbsdjl@nus.edu.sg, b.byrne@imperial.ac.uk 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Carlsson E., Ding JL., Byrne B. emails snt 5/5 for species of GST-MAL and TRAM. Table S1 primers are all of Human origin;determined by Blat. The authors have stated that GST-MAL and TRAM are of Human origin. e.carlsson11@imperial.ac.uk,dbsdjl@nus.edu.sg, b.byrne@imperial.ac.uk Accepted 2016-MAY-13 AT 15:10 BST AT 15:10 BST by ORCHARD Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation imex curation SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions. SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions. Biochimica et biophysica acta 2016 imex curation Carlsson E., Ding JL., Byrne B. emails snt 5/5 for species of GST-MAL and TRAM. Dark space = no 20? Table S1 primers are all of Human origin;determined by Blat. The authors have stated that GST-MAL and TRAM are of Human origin. e.carlsson11@imperial.ac.uk,dbsdjl@nus.edu.sg, b.byrne@imperial.ac.uk 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Carlsson E., Ding JL., Byrne B. Residues 368-537 are given for TRIF TIR domain (Table S1);however UniProt gives coordinates for the TRIF TIR domain as residues 390-460. emails snt 5/5 for species of GST-MAL and TRAM. Table S1 primers are all of Human origin;determined by Blat. The authors have stated that GST-MAL and TRAM are of Human origin. e.carlsson11@imperial.ac.uk,dbsdjl@nus.edu.sg, b.byrne@imperial.ac.uk Accepted 2016-MAY-13 AT 15:10 BST AT 15:10 BST by ORCHARD Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation imex curation sarm1_human NAD(+) hydrolase SARM1 Sterile alpha and Armadillo repeat protein Sterile alpha motif domain-containing protein 2 Tir-1 homolog SARM1 KIAA0524 SAMD2 SARM NADP(+) hydrolase SARM1 Sterile alpha and TIR motif-containing protein 1 protein protein human Homo sapiens Human MVLTLLLSAYKLCRFFAMSGPRPGAERLAVPGPDGGGGTGPWWAAGGRGPREVSPGAGTEVQDALERALPELQQALSALKQAGGARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALGNCALHGGQAVQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVERSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLLDSNRLEAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAPMGPT 6391EA4C31EF6604 tcam1_human TIR domain-containing adapter molecule 1 PRVTIRB TRIF Proline-rich, vinculin and TIR domain-containing protein B Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta Putative NF-kappa-B-activating protein 502H TICAM1 protein protein human Homo sapiens Human MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPRPIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPHGPSKLCDDPQASLVPEPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAPDATSTGLPDTPAAPETSTNYPVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSPPPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALGVPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQGSPDCVIPFLPLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE DIP protein Q8IUC6 original sequence version: 57 5D071E3BE9240D9A myd88_human Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP CEAE3F6B99524333 tirap_human Toll/interleukin-1 receptor domain-containing adapter protein MyD88 adapter-like protein Adaptor protein Wyatt TIRAP MAL protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS DIP protein P58753 original sequence version: 119 44A8454D04704540 tcam2_human TIR domain-containing adapter molecule 2 TRIF-related adapter molecule Toll/interleukin-1 receptor domain-containing protein Toll-like receptor adaptor protein 3 Putative NF-kappa-B-activating protein 502 TICAM2 TIRP TIRAP3 TRAM protein protein human Homo sapiens Human MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA 2D1171F9B04D9C4C e56e-1 3 6 unspecified role unspecified role bait bait tir sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey Q6SZW1:p.Gly601Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A Wed May 02 19:45:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly601ala' Tue Jun 30 17:48:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly601Ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tir sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 16 direct interaction direct interaction 3C myd88-sarm1-1 3 5 unspecified role unspecified role bait bait tir sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey Q6SZW1:p.Gly601Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:53:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly601ala' Tue Jun 30 18:26:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly601Ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tir sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 24 direct interaction direct interaction 3Ci ticam1-sarm1-1 3 6 unspecified role unspecified role prey prey tir sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range GB1_tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait Q6SZW1:p.Gly601Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:08:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly601ala' Tue Jun 30 19:52:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly601Ala' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range bb_loop sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 33 27 direct interaction direct interaction 7 myd88-sarm1-2 2 6 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2 myd88-sarm1-4 1 6 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component region rhodamine label rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bb_loop sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization 7B tirap-sarm1-1 3 7 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey Q6SZW1:p.Gly601Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A Wed May 02 19:54:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly601ala' Tue Jun 30 17:00:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly601Ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tir sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 3Cii ticam2-sarm1-1 3 8 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6SZW1:p.Gly601Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A Wed May 02 16:59:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly601ala' Tue Jun 30 20:17:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly601Ala' tir sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 3Ciii A very weak interaction