IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Progesterone receptor modulates ERα action in breast cancer. Progesterone receptor modulates ERα action in breast cancer. Nature 2015 imex curation Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? RIME:(rapid immunoprecipitation mass spectrometry of endogenous proteins). Cells were SILAC-labelled, Crosslinked with formaldehyde after hormone treatment (Progesterone, or the synthetic progestin R5020, or Ethanol), then IP-ed using anti-PR or ER-alpha antibodies and associated proteins identified by MS/MS. jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au Accepted 2017-JAN-27 AT 09:17 GMT AT 09:17 GMT by ORCHARD Nature 2015 imex curation I have added several new experiments as X-link for Interaction Detection, with IP within 'Variable Condits'- but high confidence?? Also added one ChIp expt. Progesterone receptor modulates ERα action in breast cancer. Progesterone receptor modulates ERα action in breast cancer. Nature 2015 imex curation Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? RIME:(rapid immunoprecipitation mass spectrometry of endogenous proteins). Cells were SILAC-labelled, Crosslinked with formaldehyde after hormone treatment (Progesterone, or the synthetic progestin R5020, or Ethanol), then IP-ed using anti-PR or ER-alpha antibodies and associated proteins identified by MS/MS. jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au Accepted 2017-JAN-27 AT 09:17 GMT AT 09:17 GMT by ORCHARD Nature 2015 imex curation I have added several new experiments as X-link for Interaction Detection, with IP within 'Variable Condits'- but high confidence?? Also added one ChIp expt. Progesterone receptor modulates ERα action in breast cancer. Progesterone receptor modulates ERα action in breast cancer. Nature 2015 imex curation Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au Accepted 2017-JAN-27 AT 09:17 GMT AT 09:17 GMT by ORCHARD Nature 2015 imex curation I have added several new experiments as X-link for Interaction Detection, with IP within 'Variable Condits'- but high confidence?? Also added one ChIp expt. Progesterone receptor modulates ERα action in breast cancer. Progesterone receptor modulates ERα action in breast cancer. Nature 2015 imex curation Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au Accepted 2017-JAN-27 AT 09:17 GMT AT 09:17 GMT by ORCHARD Nature 2015 imex curation I have added several new experiments as X-link for Interaction Detection, with IP within 'Variable Condits'- but high confidence?? Also added one ChIp expt. Progesterone receptor modulates ERα action in breast cancer. Progesterone receptor modulates ERα action in breast cancer. Nature 2015 imex curation Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mohammed H., Russell IA., Stark R., Rueda OM., Hickey TE., Tarulli GA., Serandour AA., Birrell SN., Bruna A., Saadi A., Menon S., Hadfield J., Pugh M., Raj GV., Brown GD., D'Santos C., Robinson JL., Silva G., Launchbury R., Perou CM., Stingl J., Caldas C., Tilley WD., Carroll JS. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar ? validity of RIME method as in email 27/10 (this publication is still reserved by Lucasz -no reply to email) -is he on_holiday/ill or dead/peeved? jason.carroll@cruk.cam.ac.uk,wayne.tilley@adelaide.edu.au Accepted 2017-JAN-27 AT 09:17 GMT AT 09:17 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar Nature 2015 imex curation I have added several new experiments as X-link for Interaction Detection, with IP within 'Variable Condits'- but high confidence?? Also added one ChIp expt. ncoa3_human Nuclear receptor coactivator 3 NCOA3 AIB1 RAC3 Thyroid hormone receptor activator molecule 1 Receptor-associated coactivator 3 BHLHE42 Steroid receptor coactivator protein 3 CBP-interacting protein Amplified in breast cancer 1 protein ACTR Class E basic helix-loop-helix protein 42 TRAM1 protein protein human Homo sapiens Human MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNGVSWTNETQRQKSHTFNCRMLMKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLADPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSPKIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLKSSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGSSMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPTLPLRSNSIPGARPVLQQQQQMLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSMEQVSHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENPTAGGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPTMPQAPPQQFPYQPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC DIP protein Q9Y6Q9 original sequence version: 162 DIP protein Q9Y6Q9 original sequence version: 155 DIP protein Q9Y6Q9 original sequence version: 91 732CDF0423161679 prgr_human Progesterone receptor PGR NR3C3 Nuclear receptor subfamily 3 group C member 3 protein protein human Homo sapiens Human MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLGPPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK DIP protein P06401 original sequence version: 196 DIP protein P06401-1 original sequence version: 186 DIP protein P06401-1 original sequence version: 192 80452E54FF3A0454 sumo2_human Small ubiquitin-related modifier 2 SMT3 homolog 2 Sentrin-2 HSMT3 SUMO-3 SUMO2 SMT3H2 SMT3B Ubiquitin-like protein SMT3B protein protein human Homo sapiens Human MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY DIP protein P61956 original sequence version: 39 DIP protein P61956 original sequence version: 79 DIP protein P61956 original sequence version: 81 DIP protein P61956 original sequence version: 77 DIP protein P61956 original sequence version: 98 DIP protein P61956 original sequence version: 116 DIP protein P61956 original sequence version: 141 F8F0426849BEF08B gata3_human Trans-acting T-cell-specific transcription factor GATA-3 GATA3 GATA-binding factor 3 protein protein human Homo sapiens Human MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAMG DIP protein P23771 original sequence version: 160 F24C58681E1D02A5 grhl2_human Grainyhead-like protein 2 homolog GRHL2 BOM Brother of mammalian grainyhead TFCP2L3 Transcription factor CP2-like 3 protein protein human Homo sapiens Human MSQESDNNKRLVALVPMPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGLLYDYYKVPRDKRLLSVSKASDSQEDQEKRNCLGTSEAQSNLSGGENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITLSETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEIAYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKGAERKIRDEERKQNRKKGKGQASQTQCNSSSDGKLAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRVLLYVRKETDDVFDALMLKSPTVKGLMEAISEKYGLPVEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKVTLMEI 147CF33798248BB6 pkcb1_human_gene Protein kinase C-binding protein 1 ZMYND8 KIAA1125 PRKCBP1 RACK7 gene gene human Homo sapiens Human tle3_human Transducin-like enhancer protein 3 Enhancer of split groucho-like protein 3 TLE3 KIAA1547 protein protein human Homo sapiens Human MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQQQLQAQHLSHATHGPPVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLTVKDEKNHHELDHRERESSANNSVSPSESLRASEKHRGSADYSMEAKKRKAEEKDSLSRYDSDGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARSLKKDAPTSPASVASSSSTPSSKTKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPIGIMASALRTPISITSSYAAPFAMMSHHEMNGSLTSPGAYAGLHNIPPQMSAAAAAAAAAYGRSPMVSFGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY DIP protein Q04726 original sequence version: 155 A2A469D73BF04A43 esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV DIP protein P03372 original sequence version: 214 DIP protein P03372 original sequence version: 139 DIP protein P03372 original sequence version: 167 5455C57AB0CCCAA7 co4a_human Complement C4-A C4A CO4 CPAMD2 Acidic complement C4 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2 protein protein human Homo sapiens Human MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRNPSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLESQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSWYFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQDIQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPSFYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVALGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQWTLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV 9396A4CC4DA3602C nrip1_human Nuclear receptor-interacting protein 1 Nuclear factor RIP140 Receptor-interacting protein 140 NRIP1 protein protein human Homo sapiens Human MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAVDKKSAGHNEEDQNFNISGSAFPTCQSNGPVLNTHTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIMNLNVKKEALLAGMVDSVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHDSLKVEKDLRCYGVASSHLKTLLKKSKVKDQKPDTNLPDVTKNLIRDRFAESPHHVGQSGTKVMSEPLSCAARLQAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQAANNSLLLHLLKSQTIPKPMNGHSHSERGSIFEESSTPTTIDEYSDNNPSFTDDSSGDESSYSNCVPIDLSCKHRTEKSESDQPVSLDNFTQSLLNTWDPKVPDVDIKEDQDTSKNSKLNSHQKVTLLQLLLGHKNEENVEKNTSPQGVHNDVSKFNTQNYARTSVIESPSTNRTTPVSTPPLLTSSKAGSPINLSQHSLVIKWNSPPYVCSTQSEKLTNTASNHSMDLTKSKDPPGEKPAQNEGAQNSATFSASKLLQNLAQCGMQSSMSVEEQRPSKQLLTGNTDKPIGMIDRLNSPLLSNKTNAVEENKAFSSQPTGPEPGLSGSEIENLLERRTVLQLLLGNPNKGKSEKKEKTPLRDESTQEHSERALSEQILMVKIKSEPCDDLQIPNTNVHLSHDAKSAPFLGMAPAVQRSAPALPVSEDFKSEPVSPQDFSFSKNGLLSRLLRQNQDSYLADDSDRSHRNNEMALLESKNLCMVPKKRKLYTEPLENPFKKMKNNIVDAANNHSAPEVLYGSLLNQEELKFSRNDLEFKYPAGHGSASESEHRSWARESKSFNVLKQLLLSENCVRDLSPHRSNSVADSKKKGHKNNVTNSKPEFSISSLNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGCAGSRPESGLLNGCSMPSEKGPIKWVITDAEKNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFNLRSPYNSHMGNNASRPHSANGEVYGLLGSVLTIKKESE 81FC424968E9A5F6 nfib_human_gene Nuclear factor 1B NFIB gene gene human Homo sapiens Human gsg1_human_gene Germ cell-specific gene 1 protein GSG1 gene gene human Homo sapiens Human nbpf1_human_gene NBPF1 gene gene human Homo sapiens Human trps1_human Zinc finger transcription factor Trps1 Tricho-rhino-phalangeal syndrome type I protein Zinc finger protein GC79 TRPS1 protein protein human Homo sapiens Human MVRKKNPPLRNVASEGEGQILEPIGTESKVSGKNKEFSADQMSENTDQSDAAELNHKEEHSLHVQDPSSSSKKDLKSAVLSEKAGFNYESPSKGGNFPSFPHDEVTDRNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLETKEDQKMSPKATEETGQAQSGQANCQGLSPVSVASKNPQVPSDGGVRLNKSKTDLLVNDNPDPAPLSPELQDFKCNICGYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVFSGVLQDINSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSSTELEQHFLQTHPNKIKASLPSSEVAKPSEKNSNKSIPALQSSDSGDLGKWQDKITVKAGDDTPVGYSVPIKPLDSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGAVQSGGLNPELNDKLSRGSVINQNDLAKSSEGETMTKTDKSSSGAKKKDFSSKGAEDNMVTSYNCQFCDFRYSKSHGPDVIVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFACRKSNCSHCALLLLHLSPGAAGSSRVKHQCHQCSFTTPDVDVLLFHYESVHESQASDVKQEANHLQGSDGQQSVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSLLEHFNTVHCQEQDITTANGEEDGHAISTIKEEPKIDFRVYNLLTPDSKMGEPVSESVVKREKLEEKDGLKEKVWTESSSDDLRNVTWRGADILRGSPSYTQASLGLLTPVSGTQEQTKTLRDSPNVEAAHLARPIYGLAVETKGFLQGAPAGGEKSGALPQQYPASGENKSKDESQSLLRRRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRRTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSPIEKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE 2157B04F5BEB71CC esr1-pgr-20 4 13 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 1C Two bands were detected for PR;it is not clear which PR isoforms are detected as the antibody used would detect a third isoform of PR (P06401-5) with Mwt of ~90kDa, that would also react with the antibody used. esr1-pgr-1 5 13 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 1C Two bands were detected for PR;it is not clear which PR isoforms are detected as the antibody used would detect a third isoform of PR (P06401-5) with Mwt of ~90kDa, that would also react with the antibody used. c4a-esr1-4 2 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Figure 1A Progesterone (CHEBI:17026) Immunoprecipitation using antibody to Progesterone Receptor c4a-esr1-1 2 7 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component physical association physical association Figure 1B Immunoprecipitation using antibody to ER-alpha Progesterone (CHEBI:17026) c4a-esr1-2 2 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association Extended Data Fig 1A Promegestone R5020 (CHEBI:73390), a synthetic progestin, treatment for 10800 seconds Immunoprecipitation using antibody to Progesterone Receptor esr1-pgr-21 2 13 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Extended Data Figure 1B/C It is stated that PR isoform B (P06401-1) is detected, but as Isoform 5 has the same sequence at the N terminal region it is not possible to distinguish these isoforms. Promegestone R5020 (CHEBI:73390), a synthetic progestin, treatment for 10800 seconds Immunoprecipitation using antibody to ER-alpha c4a-esr1-3 1 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Figure 1A Progesterone (CHEBI:17026) Immunoprecipitation using antibody to Progesterone Receptor esr1-gata3-1 1 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association Extended Data Fig 1A Promegestone R5020 (CHEBI:73390), a synthetic progestin, treatment for 10800 seconds Immunoprecipitation using antibody to Progesterone Receptor esr1-pgr-22 1 7 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component physical association physical association Figure 1B Progesterone (CHEBI:17026) Immunoprecipitation using antibody to ER-alpha esr1-pgr-23 1 13 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Extended Data Figure 1B/C It is stated that PR isoform B (P06401-1) is detected, but as Isoform 5 has the same sequence at the N terminal region it is not possible to distinguish these isoforms. Promegestone R5020 (CHEBI:73390), a synthetic progestin, treatment for 10800 seconds Immunoprecipitation using antibody to ER-alpha w6s54yet-1 3 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association Extended Data Fig 4A In the absence of Progesterone, ER-alpha is not able to associate with the progesterone-induced binding sites. Progesterone- CHEBI:17026 CHEBI:17026 is required for the binding of P03372 to ENSG00000101040 esr1-zmynd8-1 3 18 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association Extended Data Fig 4Ai In the absence of Progesterone, ER-alpha is not able to associate with the progesterone-induced binding sites. Progesterone- CHEBI:17026 CHEBI:17026 is required for the binding of P03372 to ENSG00000219481 It has been assumed that the "NBPF" gene refers to "NBPF1". the Ensembl gene for NBPF1 does not give the Reviewed Uniprot protein-Q3BBV0- as a link, only gives Trembl entries with "protein existence predicted", and UniProt Q3BBV0 does not link to ENSG00000219481. Odd-contacted Ensembl-reply?? esr1-zmynd8-2 3 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association Extended Data Fig 4Ai In the absence of Progesterone, ER-alpha is not able to associate with the progesterone-induced binding sites. Progesterone- CHEBI:17026 CHEBI:17026 is required for the binding of P03372 to ENSG00000111305 esr1-gsg1-1 3 16 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association Extended Data Fig 4Aii In the absence of Progesterone, ER-alpha is not able to associate with the progesterone-induced binding sites. Progesterone- CHEBI:17026 CHEBI:17026 is required for the binding of P03372 to ENSG00000147862