UniProt UniProt http://www.uniprot.org SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. Journal of cell science 2015 imex curation Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-nt2d1 human NTERA-2 d.D1 (NT2D1) testicular embryonal carcinoma cell line Human nt2d1 NTERA-2 d.D1 (NT2D1) human testicular embryonal carcinoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw Accepted 2017-JAN-17 AT 10:12 GMT AT 10:12 GMT by MGT Journal of cell science 2015 imex curation thanks. according to your mail 21.12. it seems all is sorted out. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. Journal of cell science 2015 imex curation Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-nt2d1 human NTERA-2 d.D1 (NT2D1) testicular embryonal carcinoma cell line Human nt2d1 NTERA-2 d.D1 (NT2D1) human testicular embryonal carcinoma cell line fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw Accepted 2017-JAN-17 AT 10:12 GMT AT 10:12 GMT by MGT Journal of cell science 2015 imex curation thanks. according to your mail 21.12. it seems all is sorted out. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. Journal of cell science 2015 imex curation Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. Figure 3B; above the Western Blot it is shown that HA-SEPT2 was transfected, but on the image legend (below) it is stated that HA-SEPT4 was transfected. From the text if has been assumed HA-SEPT4 was the transfectant. paolink@mail.ncku.edu.tw Accepted 2017-JAN-17 AT 10:12 GMT AT 10:12 GMT by MGT Journal of cell science 2015 imex curation thanks. according to your mail 21.12. it seems all is sorted out. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. Journal of cell science 2015 imex curation Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-nt2d1 human NTERA-2 d.D1 (NT2D1) testicular embryonal carcinoma cell line Human nt2d1 NTERA-2 d.D1 (NT2D1) human testicular embryonal carcinoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw Accepted 2017-JAN-17 AT 10:12 GMT AT 10:12 GMT by MGT Journal of cell science 2015 imex curation thanks. according to your mail 21.12. it seems all is sorted out. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. Journal of cell science 2015 imex curation Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-sperm Homo sapiens - sperm sperm fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw Accepted 2017-JAN-17 AT 10:12 GMT AT 10:12 GMT by MGT Journal of cell science 2015 imex curation thanks. according to your mail 21.12. it seems all is sorted out. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins. Journal of cell science 2015 imex curation Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions mouse-sperm Mouse sperm sperm fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kuo YC., Shen YR., Chen HI., Lin YH., Wang YY., Chen YR., Wang CY., Kuo PL. paolink@mail.ncku.edu.tw Accepted 2017-JAN-17 AT 10:12 GMT AT 10:12 GMT by MGT Journal of cell science 2015 imex curation thanks. according to your mail 21.12. it seems all is sorted out. sept2_human Septin-2 SEPTIN2 DIFF6 KIAA0158 NEDD5 Neural precursor cell expressed developmentally down-regulated protein 5 SEPT2 protein protein human Homo sapiens Human MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDGDGGALGHHV 12CCBBE30806F92F 12CCBBE30806F92F sept4_human Septin-4 SEPTIN4 ARTS Apoptosis-related protein in the TGF-beta signaling pathway Bradeion beta Brain protein H5 CE5B3 beta Cell division control-related protein 2 Cerebral protein 7 PNUTL2 Peanut-like protein 2 SEP4 SEPT4 hucep-7 C17orf47 protein protein human Homo sapiens Human MDRSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKENY 2F08D3611EF6523D q9d451_mouse Septin12 Sept12 protein protein mouse Mus musculus Mouse MDERRSPSPCSSRPSSPRTPPNEMFGPVGIEAVLDQLRIKAMKTGFEFNIMVVGQSGLGKSTMVNTLFKSKVWQSTEPNLDVPMPQTLELHSVTHVIEEKGLKLKLTVTDTPGFGDQINNDKCWDPILSYINQQYEQYLQEELLITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLRRLCRTVNVVPVIARADSLTIEERDAFRSRIQQNLKTHCIDVYPQKCFDEDVNDRLLNSKIREQIPFAVVGADREHIVNGRCVLGRKTKWGIIEGKFGNIAGMQWVGGWKSGHTLHAWHPMHASPGVCPTWMATMTCKT 43096E70A0D8AE34 sep12_human Septin-12 SEPTIN12 SEPT12 protein protein human Homo sapiens Human MDPLRRSPSPCLSSQPSSPSTPPCEMLGPVGIEAVLDQLKIKAMKMGFEFNIMVVGQSGLGKSTMVNTLFKSKVWKSNPPGLGVPTPQTLQLHSLTHVIEEKGVKLKLTVTDTPGFGDQINNDNCWDPILGYINEQYEQYLQEEILITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFDEDINDKILNSKLRDRIPFAVVGADQEHLVNGRCVLGRKTKWGIIEVENMAHCEFPLLRDLLIRSHLQDLKDITHNIHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGAHDDSDDEF 31968F366DEFB4FD sept6_mouse Septin-6 Septin6 Kiaa0128 Sept6 protein protein mouse Mus musculus Mouse MAAADIARQVGEDCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVGLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHSYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPVIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVSEINGTMNAHLPFAVVGSTEEVKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQEEKKKLEDKKKCLDEEMNAFKQRKAAAELLQSQGSQAGGSQTLKRDKEKKNNPWLCIE 33DCD4F44607168A sept6_human Septin-6 SEPTIN6 KIAA0128 SEP2 SEPT6 protein protein human Homo sapiens Human MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLKRDKEKKNNPWLCTE DIP protein Q14141 original sequence version: 120 DIP protein Q14141 original sequence version: 152 DIP protein Q14141 original sequence version: 128 E684AE6A93B32362 sept7_mouse Septin-7 Septin7 CDC10 protein homolog Cdc10 Sept7 protein protein mouse Mus musculus Mouse MSVSARSAAAEERSVNCGTMAQPKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQRILEQQNSSRTLEKNKKKGKIF 1028CCF14023059C sept7_human Septin-7 SEPTIN7 CDC10 CDC10 protein homolog SEPT7 protein protein human Homo sapiens Human MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF DIP protein Q16181 original sequence version: 122 DIP protein Q16181 original sequence version: 130 946A08C54B7124FF sept2_mouse Septin-2 Sept2 Septin2 Nedd5 Neural precursor cell expressed developmentally down-regulated protein 5 protein protein mouse Mus musculus Mouse MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDSDSGALGQHV DIP protein P42208 original sequence version: 95 DIP protein P42208 original sequence version: 126 C4BFFB3F1815E081 sept12-sept7-1 5 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component Q8IYM1:p.Asp197Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 17:32:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp197asn' Tue Jun 30 18:36:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp197Asn' colocalization colocalization 1A, 6A ,6E sept12-sept6-4 5 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component Q8IYM1:p.Asp197Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 18:46:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp197asn' Tue Jun 30 17:18:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp197Asn' colocalization colocalization 1B, 6B, 6F sept12-sept2-1 5 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component Q8IYM1:p.Asp197Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 15:00:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp197asn' Tue Jun 30 20:00:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp197Asn' colocalization colocalization 1C, 6C, 6G sept12-sept4-2 5 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component Q8IYM1:p.Asp197Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 17:02:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp197asn' Tue Jun 30 16:48:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp197Asn' colocalization colocalization 1D, 6D, 6H sept12-sept7-2 4 14 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2A sept2-sept12-1 4 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2B sept12-sept6-5 4 12 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2A sept12-sept4-3 4 8 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2A sept12-sept7-3 4 14 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2B sept12-sept6-6 4 12 unspecified role unspecified role bait bait c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2B sept4-sept12-1 4 8 unspecified role unspecified role bait bait c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2B sept12-sept2-2 1 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2A sept12-sept7-4 2 14 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 2C sept12-sept6-7 2 12 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 2C sept12-sept2-3 2 7 unspecified role unspecified role neutral component neutral component 10 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 2C sept12-sept2-4 3 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8IYM1:p.Thr89Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T M Wed May 02 18:04:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr89met' Tue Jun 30 16:32:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr89Met' Q8IYM1:p.Asp197Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D N Wed May 02 17:02:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp197asn' Tue Jun 30 19:49:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp197Asn' association association 3A (lane 1), supplementary S4 Without SEPT7 overexpression, the interactions between SEPT12 and SEPT2 as well as SEPT6 were dramatically reduced. sept12-sept4-4 3 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 3B (lane 1) Without SEPT7 overexpression, the interactions between SEPT12 and SEPT4 as well as SEPT6 were dramatically reduced. sept7-sept12-1 4 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range g_septin_dom sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range g_septin_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 111 108 physical association physical association 4A Sept7 GTP-binding domain (GBD) is stated to be aas 28-298 in Methods section; however Supp fig 2 gives the GBD as aas 47-317. (UniProt gives the GBD as aas 47-318). sept12-sept7-5 4 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range g_septin_dom sufficient to bind sufficient binding region sufficient to bind range range range range binding site range is ambiguously described in publication 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range g_septin_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 118 115 physical association physical association 4A Sept7 GTP-binding domain (GBD) is stated to be aas 28-298 in Methods section; however Supp fig 2 gives the GBD as aas 47-317. (UniProt gives the GBD as aas 47-318). sept12-sept7-6 4 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8IYM1:p.Thr89Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T M Wed May 02 19:38:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr89met' Tue Jun 30 17:07:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr89Met' Q8IYM1:p.Asp197Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:24:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp197asn' Tue Jun 30 19:39:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp197Asn' physical association physical association 4D sept12-sept7-7 2 14 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8IYM1:p.Thr89Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T M Wed May 02 19:56:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr89met' Tue Jun 30 17:42:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr89Met' Q8IYM1:p.Asp197Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:27:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp197asn' Tue Jun 30 18:55:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp197Asn' colocalization colocalization 4E sept12-sept2-5 2 7 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection N+C_terminal_regions required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8IYM1:p.Thr89Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T M Wed May 02 17:18:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr89met' Wed May 02 19:01:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr89met' Tue Jun 30 19:19:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr89Met' Q8IYM1:p.Asp197Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 17:38:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp197asn' Tue Jun 30 18:22:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp197Asn' A SEPT12 construct 46-319 (missing the N and C termini) disrupts the colocalization colocalization colocalization 4F, 5E SEPT12-GBD disrupted filament formation for all four septins. sept12-sept12-1 4 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5A sept12-sept12-2 4 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5A sept12-sept12-3 4 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 5B sept12-sept12-4 4 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 5B sept12-sept12-5 4 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 5C High salt conditions sept12-sept7-8 4 7 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range g_septin_com sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association 5D sept12-sept7-9 6 13 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component Q9D451:p.Asp195Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 18:09:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp195asn' Tue Jun 30 16:29:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp195Asn' colocalization colocalization 7B sept12-1 6 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component Q9D451:p.Asp195Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:12:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp195asn' Tue Jun 30 18:13:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp195Asn' colocalization colocalization 7B sept12-10 6 15 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component Q9D451:p.Asp195Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 18:51:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp195asn' Tue Jun 30 20:23:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp195Asn' colocalization colocalization 7B sept12-sept2-6 3 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8IYM1:p.Thr89Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T M Wed May 02 18:27:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr89met' Tue Jun 30 17:46:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr89Met' Q8IYM1:p.Asp197Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D N Wed May 02 15:55:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp197asn' Tue Jun 30 17:57:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp197Asn' association association 3A (lane 2) sept12-sept7-10 3 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 3A (lane 3) sept12-sept4-5 3 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 3B (lane 3) sept12-sept4-6 3 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 3B (lane 2) sept12-sept2-7 2 7 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 4F