HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html A fine-tuned interaction between trimeric autotransporter haemophilus surface fibrils and vitronectin leads to serum resistance and adherence to respiratory epithelial cells. A fine-tuned interaction between trimeric autotransporter haemophilus surface fibrils and vitronectin leads to serum resistance and adherence to respiratory epithelial cells. Infection and immunity 2014 imex curation Singh B., Su YC., Al-Jubair T., Mukherjee O., Hallström T., Mörgelin M., Blom AM., Riesbeck K. No Taxonomic ID can be found for H. influenzae type b strain RM804, so UniProt entry Q4KTX9 (Q4KTX9_HAEIF) has been used for HSF. Vitronectin was determined to be of Human origin from previous work of the first author - Singh at al., 2010. kristian.riesbeck@med.lu.se 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Singh B., Su YC., Al-Jubair T., Mukherjee O., Hallström T., Mörgelin M., Blom AM., Riesbeck K. No Taxonomic ID can be found for H. influenzae type b strain RM804, so UniProt entry Q4KTX9 (Q4KTX9_HAEIF) has been used for HSF. Vitronectin was determined to be of Human origin from previous work of the first author - Singh at al., 2010. kristian.riesbeck@med.lu.se Accepted 2017-NOV-28 AT 11:25 GMT AT 11:25 GMT by MGT Infection and immunity 2014 imex curation A fine-tuned interaction between trimeric autotransporter haemophilus surface fibrils and vitronectin leads to serum resistance and adherence to respiratory epithelial cells. A fine-tuned interaction between trimeric autotransporter haemophilus surface fibrils and vitronectin leads to serum resistance and adherence to respiratory epithelial cells. Infection and immunity 2014 imex curation Singh B., Su YC., Al-Jubair T., Mukherjee O., Hallström T., Mörgelin M., Blom AM., Riesbeck K. No Taxonomic ID can be found for H. influenzae type b strain RM804, so UniProt entry Q4KTX9 (Q4KTX9_HAEIF) has been used for HSF. Vitronectin was determined to be of Human origin from previous work of the first author - Singh at al., 2010. kristian.riesbeck@med.lu.se 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Singh B., Su YC., Al-Jubair T., Mukherjee O., Hallström T., Mörgelin M., Blom AM., Riesbeck K. No Taxonomic ID can be found for H. influenzae type b strain RM804, so UniProt entry Q4KTX9 (Q4KTX9_HAEIF) has been used for HSF. Vitronectin was determined to be of Human origin from previous work of the first author - Singh at al., 2010. kristian.riesbeck@med.lu.se Accepted 2017-NOV-28 AT 11:25 GMT AT 11:25 GMT by MGT Infection and immunity 2014 imex curation A fine-tuned interaction between trimeric autotransporter haemophilus surface fibrils and vitronectin leads to serum resistance and adherence to respiratory epithelial cells. A fine-tuned interaction between trimeric autotransporter haemophilus surface fibrils and vitronectin leads to serum resistance and adherence to respiratory epithelial cells. Infection and immunity 2014 imex curation Singh B., Su YC., Al-Jubair T., Mukherjee O., Hallström T., Mörgelin M., Blom AM., Riesbeck K. No Taxonomic ID can be found for H. influenzae type b strain RM804, so UniProt entry Q4KTX9 (Q4KTX9_HAEIF) has been used for HSF. Vitronectin was determined to be of Human origin from previous work of the first author - Singh at al., 2010. kristian.riesbeck@med.lu.se 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Singh B., Su YC., Al-Jubair T., Mukherjee O., Hallström T., Mörgelin M., Blom AM., Riesbeck K. No Taxonomic ID can be found for H. influenzae type b strain RM804, so UniProt entry Q4KTX9 (Q4KTX9_HAEIF) has been used for HSF. Vitronectin was determined to be of Human origin from previous work of the first author - Singh at al., 2010. kristian.riesbeck@med.lu.se Accepted 2017-NOV-28 AT 11:25 GMT AT 11:25 GMT by MGT Infection and immunity 2014 imex curation vtnc_human Vitronectin VTN Serum-spreading factor V75 S-protein protein protein human Homo sapiens Human MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL DIP protein P04004 original sequence version: 115 0D6DB5591CBFEF45 q4ktx9_haeif protein protein haeif Haemophilus influenzae MNKIFNVIWNVMTQTWVVVSELTRTHTKRASATVETAVLATLLFATVQANATDEDEELDPVVRTAPVLSFHSDKEGTGEKEVTENSNWGIYFDNKGVLKAGAITLKAGDNLKIKQNTDESTNASSFTYSLKKDLTDLTSVATEKLSFGANGDKVDITSDANGLKLAKTGNGNVHLNGLDSTLPDAVTNTGVLSSSSFTPNDVEKTRAATVKDVLNAGWNIKGAKTAGGNVESVDLVSAYNNVEFITGDKNTLDVVLTAKENGKTTEVKFTPKTSVIKEKDGKLFTGKENNDTNKVTSNTATDNTDEGNGLVTAKAVIDAVNKAGWRVKTTTANGQNGDFATVASGTNVTFESGDGTTASVTKDTNGNGITVKYDAKVGDGLKFDSDKKIVADTTALTVTGGKVAEIAKEDDKKKLVNAGDLVTALGNLSWKAKAEADTDGALEGISKDQEVKAGETVTFKAGKNLKVKQDGANFTYSLQDALTGLTSITLGGTTNGGNDAKTVINKDGLTITPAGNGGTTGTNTISVTKDGIKAGNKAITNVASGLRAYDDANFDVLNNSATDLNRHVEDAYKGLLNLNEKNANKQPLVTDSTAATVGDLRKLGWVVSTKNGTKEESNQVKQADEVLFTGAGAATVTSKSENGKHTITVSVAETKADSGLEKDGDTIKLKVDNQNTDNVLTVGNNGTAVTKGGFETVKTGATDADRGKVTVKDATANDADKKVATVKDVATAINSAATFVKTENLTTSIDEDNPTDNGKDDALKAGDTLTFKAGKNLKVKRDGKNITFDLAKNLEVKTAKVSDTLTIGGNTPTGGTTATPKVNITSTADGLNFAKETADASGSKNVYLKGIATTLTEPSAGAKSSHVDLNVDATKKSNAASIEDVLRAGWNIQGNGNNVDYVATYDTVNFTDDSTGTTTVTVTQKADGKGADVKIGAKTSVIKDHNGKLFTGKGLKDANNGATVSEDDGKDTGTGLVTAKTVIDAVNKSGWRVTGEGATAETGATAVNAGNAETVTSGTSVNFKNGNATTATVSKDNGNINVKYDVNVGDGLKIGDDKKIVADTTTLTVTGGKVSVPAGANSVNNNKKLVNAEGLATALNNLSWTAKADKYADGESEGETDQEVKAGDKVTFKAGKNLKVKQSEKDFTYSLQDTLTGLTSITLGGTANGRNDTGTVINKDGLTITLANGAAAGTDASNGNTISVTKDGISAGNKEITNVKSALKTYKDTQNTAGATQPAANTAEVAKQDLVDLTKPATGAAGNGADAKAPDTTAATVGDLRGLGWVLSAKKTADETQDKEFHAAVKNANEVEFVGKNGATVSAKTDNNGKHTVTIDVAEAKVGDGLEKDTDGKIKLKVDNTDGNNLLTVDATKGASVAKGEFNAVTTDATTAQGTNANERGKVVVKGSNGATATETDKKKVATVGDVAKAINDAATFVKVENDDSATIDDSPTDDGANDALKAGDTLTLKAGKNLKVKRDGKNITFALANDLSVKSATVSDKLSLGTNGNKVNITSDTKGLNFAKDSKTGDDANIHLNGIASTLTDTLLNSGATTNLGGNGITDNEKKRAASVKDVLNAGWNVRGVKPASANNQVENIDFVATYDTVDFVSGDKDTTSVTVESKDNGKRTEVKIGAKTSVIKDHNGKLFTGKELKDANNNGVTVTETDGKDEGNGLVTAKAVIDAVNKAGWRVKTTGANGQNDDFATVASGTNVTFADGNGTTAEVTKANDGSIAVKYNVKVADGLKLDGDKIVADTTVLTVADGKVTAPNNGDGKKFVDASGLADALNKLSWTATAGKEGTGEVDPANSAGQEVKAGDKVTFKAGDNLKIKQSGKDFTYSLKKELKDLTSVEFKDANGGTGSESTKITKDGLTITPAHGAGAAGANTANTISVTKDGISAGNKAVTNVVSGLKKFGDGHTLANGTVADFEKHYDNAYKDLTNLDEKGADNNPTVADNTAATVGDLRGLGWVISADKTTGEPNQEYNAQVRNANEVKFKSGNGINVSGKTLNGTRVITFELAKGEVVKSNEFTVKNADGSETNLVKVGDMYYSKEDIDPATSKPMTGKTEKYKVENGKVVSANGSKTEVTLTNKGSGYVTGNQVADAIAKSGFELGLADAAEAEKAFAESAKDKQLSKDKAETVNAHDKVRFANGLNTKVSAATVESTDANGDKVTTTFVKTDVELPLTQIYNTDANGNKIVKKADGKWYELNADGTASNKEVTLGNVDANGKKVVKVTENGADKWYYTSADGAADKTKGEVSNDKVSTDEKHVVRLDPNNQSNGKGVVIDNVANGEISATSTDAINGSQLYAVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW C383EE95CF46C70C heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) hsf-vn-1 2 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified BD2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain PD2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 2B vn-hsf-1 2 5 inhibitor inhibitor unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C hsf-vn-2 3 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 2D hsf-vn-3 3 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait BD2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 2D hsf-vtn-2 2 4 unspecified role unspecified role prey prey purified purified region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3F & 4D q4ktx9_haeif-vtn-5 2 4 unspecified role unspecified role neutral component neutral component purified purified c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction S3 Multimeric Vn had a higher Hsf-binding capacity than monomeric Vn. Experiment for this interaction it not stated to be an ELISA, but probably is. q4ktx9_haeif-vtn-2 1 4 unspecified role unspecified role neutral component neutral component purified purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association S4 q4ktx9_haeif-vtn-3 2 4 unspecified role unspecified role prey prey purified purified c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 6A q4ktx9_haeif-vtn-4 2 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C and 4 q4ktx9_haeif-vtn-6 2 6 inhibitor inhibitor unspecified role unspecified role 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C q4ktx9_haeif-vtn-7 2 5 inhibitor inhibitor unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C q4ktx9_haeif-vtn-8 2 5 inhibitor inhibitor unspecified role unspecified role purified purified BD2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C