IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Circulation research 2013 imex curation Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-retina Mus musculus retina retina retinal tissue confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de Accepted 2017-AUG-09 AT 15:40 BST AT 15:40 BST by PPORRAS Circulation research 2013 Only protein-protein interactions imex curation imex curation Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Circulation research 2013 imex curation Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. lumier luminescence based mammalian interactome mapping lumier tag luciferase tag visualisation by luciferase assay tag luciferase Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de Accepted 2017-AUG-09 AT 15:40 BST AT 15:40 BST by PPORRAS Circulation research 2013 Only protein-protein interactions imex curation imex curation Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Circulation research 2013 imex curation Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? Human umbilical vein endothelial cells The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de Accepted 2017-AUG-09 AT 15:40 BST AT 15:40 BST by PPORRAS Circulation research 2013 Only protein-protein interactions imex curation imex curation Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Circulation research 2013 imex curation Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? Human umbilical vein endothelial cells The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de Accepted 2017-AUG-09 AT 15:40 BST AT 15:40 BST by PPORRAS Circulation research 2013 Only protein-protein interactions imex curation imex curation Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis. Circulation research 2013 imex curation Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Adam MG., Berger C., Feldner A., Yang WJ., Wüstehube-Lausch J., Herberich SE., Pinder M., Gesierich S., Hammes HP., Augustin HG., Fischer A. Ddark space = no 26? The authors have stated that the origins of proteins/constructs used are as follows:- Figure 1A -Y2H experiments:pGBK-Dll1 and Dll4: both were from mouse Figure 1D and 2A:DLL4 and SYNJ2BP are of Human origin in both instances. Positive control interaction JUN-FOs reported in figure 1C is not entered since details of the constructs used could not be ascertained. a.fischer@dkfz-heidelberg.de Accepted 2017-AUG-09 AT 15:40 BST AT 15:40 BST by PPORRAS mouse embryo E13 cDNA library Circulation research 2013 Only protein-protein interactions imex curation imex curation syj2b_human Synaptojanin-2-binding protein Mitochondrial outer membrane protein 25 SYNJ2BP OMP25 protein protein human Homo sapiens Human MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMRYRQQL A62A82AC06A64995 mpdz_mouse Multiple PDZ domain protein Mpdz Mupp1 Multi-PDZ domain protein 1 protein protein mouse Mus musculus Mouse MLETIDKNRALQAAERLQSKLKERGDVANEDKLSLLKSVLQSPLFSQILNLQTSLQQLKDQVNIATLATAAADHAHTPQFSSAVISNLQSESLLLSPNHGNLEALPGPGAPAVMDGKPTCDELDQLIKNMAQGRHVEIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIARGSLPPVSSPRISRSPSAASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKDEESLSLKRNTSILPIEEEGFPLLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKPLPLSPEEGYVSAKEDAFLCSPHACKESGLSDKALFRADLALIDTPDAESIAESRFESQFSPDNDSVYSTQASIFSLHDGTCSDGMNYGPSLPSSPPKDVTSSSEVVLGLHLSLEELYTQNLLQRQHAGSPPTDMRPAPTSGFPISDYTTTNAVEQKYECANPVAWPHSQLPSSLSTSELAPALPAVAQKYLTDQSSLASDAESVNLQSMSQEAFERTVTIAKGSSSLGMTVSANKDGLGVIVRSIIHGGAISRDGRIAVGDCILSINEESTISLTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFRVSFGQQAGGIMALDIFSSYTGRDIPELPEREEGEGEESELQNAAYSSWSQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGYSWKNIQERYGSLTGQLHVIELEKGQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAICEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSRSSTPAVFASDPATCPIIPGCETTIEISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFHSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLS DIP protein Q8VBX6 original sequence version: 55 mint Interacts with HTR2C and provokes its clustering at the cell surface. Member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses 26EA94B814214B69 dll4_mouse Delta-like protein 4 Dll4 Drosophila Delta homolog 4 protein protein mouse Mus musculus Mouse MTPASRSACRWALLLLAVLWPQQRAAGSGIFQLRLQEFVNQRGMLANGQSCEPGCRTFFRICLKHFQATFSEGPCTFGNVSTPVLGTNSFVVRDKNSGSGRNPLQLPFNFTWPGTFSLNIQAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKIWRTDEQNDTLTRLSYSYRVICSDNYYGESCSRLCKKRDDHFGHYECQPDGSLSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECICRPGWQGRLCNECIPHNGCRHGTCSIPWQCACDEGWGGLFCDQDLNYCTHHSPCKNGSTCSNSGPKGYTCTCLPGYTGEHCELGLSKCASNPCRNGGSCKDQENSYHCLCPPGYYGQHCEHSTLTCADSPCFNGGSCRERNQGSSYACECPPNFTGSNCEKKVDRCTSNPCANGGQCQNRGPSRTCRCRPGFTGTHCELHISDCARSPCAHGGTCHDLENGPVCTCPAGFSGRRCEVRITHDACASGPCFNGATCYTGLSPNNFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLVVLLVLLVMVVVAVRQLRLRRPDDESREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKSNCGKLQNHTLDYNLAPGLLGRGGMPGKYPHSDKSLGEKVPLRLHSEKPECRISAICSPRDSMYQSVCLISEERNECVIATEV E7DD4FC15C4AFFBA dll1_human Delta-like protein 1 DLL1 Drosophila Delta homolog 1 UNQ146/PRO172 protein protein human Homo sapiens Human MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQGGPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIATEV 094B8F235DFD899D dll4_human Delta-like protein 4 DLL4 Drosophila Delta homolog 4 UNQ1895/PRO4341 protein protein human Homo sapiens Human MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCEHSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNRGPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAVLLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICSPRDSMYQSVCLISEERNECVIATEV 6CF89D3C220ACC89 magi2_mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 Magi2 Acvrinp1 Arip1 Aip1 Membrane-associated guanylate kinase inverted 2 Atrophin-1-interacting protein 1 Activin receptor-interacting protein 1 protein protein mouse Mus musculus Mouse MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKLVSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGSVDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEEFMELEKSGALLESGTYEDNYYGTPKPPAEPAPLLNVTDQILPGATPSAEGKRKRNKSVTNMEKASIEPPEEEEEERPVVNGNGVVITPESSEHEDKSAGASGETPSQPYPAPVYSQPEELKDQMDDTKPTKPEENEDSDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGAKPLQAPGFREKPLFTRDASQLKGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPADGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPVGSETSLIIHRGGFFSPWKTPKPMMDRWENQGSPQTSLSAPAVPQNLPFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSEKQSPMAQQHSPLAQQSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGGDYSQPPPLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYGMVPSSLSMCMKSDKHGSPYFYLLGHPKDTTNPTPGVLPLPPPQACRK F17DC52517806354 dll1_mouse Delta-like protein 1 Dll1 Drosophila Delta homolog 1 protein protein mouse Mus musculus Mouse MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGDRGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNGATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCKNGASCTDLEDSFSCTCPPGFYGKVCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPLGFSGFNCEKKMDLCGSSPCSNGAKCVDLGNSYLCRCQAGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGKNCSAPVSRCEHAPCHNGATCHQRGQRYMCECAQGYGGPNCQFLLPEPPPGPMVVDLSERHMESQGGPFPWVAVCAGVVLVLLLLLGCAAVVVCVRLKLQKHQPPPEPCGGETETMNNLANCQREKDVSVSIIGATQIKNTNKKADFHGDHGAEKSSFKVRYPTVDYNLVRDLKGDEATVRDTHSKRDTKCQSQSSAGEEKIAPTLRGGEIPDRKRPESVYSTSKDTKYQSVYVLSAEKDECVIATEV DIP protein Q61483 original sequence version: 83 9D570B9DC7EEC75E magi3_mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 Magi3 Membrane-associated guanylate kinase inverted 3 Kiaa1634 protein protein mouse Mus musculus Mouse MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLRDEAGGGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEEEDEDKEAVNGSGSMETREMHSETSDCWMKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNWEMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDHLNQKTQFENPVEEAKRKKQLGQAEIHSAKTDVERAHFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLVPVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNTQDFKLGAMVLDQNGKSGQILASDRLNGPSESSEQRASLASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPCSPTKTAKTKTDTKENSGSLETINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDESHQAFSQNGSPRLNRAELPTRSAPQEAYDVTLQRKENEGFGFVILTSKSKPPPGVIPHKIGRVIDGSPADRCGGLKVGDHISAVNGQSIVDLSHDNIVQLIKDAGVTVTLTVVAEEEHHGPPSGTNSARQSPALQHRPMGQAQANHIPGDRIALEGEIGRDVCSSYRHSWSDHKHLAQPDTAVISVVGSRHNQSLGCYPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGITHTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDTNSPSSSNVIYDEQPPPLPSSHSASTFEESHVPATEDSLTRVQICEKAEELKDTVQEKKSTLNGSQPEMKYQSVHKTMSKKDPPRGSGHGEKSRLKGENGVTRRGRSASPKKSVNRHSEEHLEKIPRPLKSDPKEKSRDRSLSPRKGESKGRLTIKAGSGQDPYRKDRGRSSSPKKQQKIGGNSLSNTEGKLSEAGSRRAAGHPRDSTEQLPDGREKSGVSRKDLKQSQPGKTRTKSPEKKSSKVDETSLPSKKTSSTAGRVVSEKEKGKKPTAGETSRETVEHTQISAKQLKQEAQEKTALGNADDHKGRESEVTDRCRERAGCTPQSSSLVKKAPITPGPWRVPRANKVTGTTGMADKQL mint A9F041B5EA4B6F3F syj2b_mouse Synaptojanin-2-binding protein Synj2bp Arip2 Omp25 Activin receptor-interacting protein 2 Activin receptor-interacting protein 4 Mitochondrial outer membrane protein 25 protein protein mouse Mus musculus Mouse MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGCAVSLRVQHRLPVQNGPIVHRGEGEPSGVPVAMVLLPVFALTMVAVWAFVRYRKQL BB40BB0114084F67 36w346-1 5 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait c_terminal_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A-1 dll4-magi2-1 5 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait c_terminal_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A-2 dll1-magi3-1 5 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait c_terminal_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A-3 dll4-magi2-2 5 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait c_terminal_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A-4 dll1-mpdz-1 5 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait c_terminal_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A-5 dll4-mpdz-1 5 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait c_terminal_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A-6 dll1-magi2-1 5 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait c_terminal_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A-7 dll4-synj2bp-1 5 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait c_terminal_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A-8 synj2bp-dll1-1 2 9 unspecified role unspecified role prey prey region renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association fig 1C synj2bp-dll4-1 2 10 unspecified role unspecified role prey prey region renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association fig 1Ci 23q5rwqer-1 1 14 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 2D Colocalization was seen with DLL4 in stalk cells synj2bp-dll4-2 3 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1D synj2bp-dll4-4 4 10 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 2A SYNJ2BP protein expression was observed in intracellular vesicles and also at the cell membrane, and partially colocalized with DLL4.