IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Unexpected expansion of tRNA substrate recognition by the yeast m1G9 methyltransferase Trm10. Unexpected expansion of tRNA substrate recognition by the yeast m1G9 methyltransferase Trm10. RNA (New York, N.Y.) 2013 imex curation Swinehart WE., Henderson JC., Jackman JE. jackman.14@osu.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as autoradiography autoradiography Swinehart WE., Henderson JC., Jackman JE. The reaction was performed in the precence of 0.5mM SAM The p methyl G was resolved from (unmethylated) p G by TLC and visualized by autoradiography. jackman.14@osu.edu Accepted 2016-SEP-28 AT 11:02 BST AT 11:02 BST by MGT RNA (New York, N.Y.) 2013 imex curation Unexpected expansion of tRNA substrate recognition by the yeast m1G9 methyltransferase Trm10. Unexpected expansion of tRNA substrate recognition by the yeast m1G9 methyltransferase Trm10. RNA (New York, N.Y.) 2013 imex curation Swinehart WE., Henderson JC., Jackman JE. jackman.14@osu.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as primer extension assay primer extension assay primer extension assay Swinehart WE., Henderson JC., Jackman JE. jackman.14@osu.edu Accepted 2016-SEP-28 AT 11:02 BST AT 11:02 BST by MGT RNA (New York, N.Y.) 2013 imex curation trm10_yeast tRNA (guanine(9)-N1)-methyltransferase TRM10 tRNA methyltransferase 10 tRNA(m1G9)-methyltransferase O0926 YOL093W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNDEINQNEEKVKRTPPLPPVPEGMSKKQWKKMCKRQRWEENKAKYNAERRVKKKRLRHERSAKIQEYIDRGEEVPQELIREPRINVNQTDSGIEIILDCSFDELMNDKEIVSLSNQVTRAYSANRRANHFAEIKVAPFDKRLKQRFETTLKNTNYENWNHFKFLPDDKIMFGDEHISKDKIVYLTADTEEKLEKLEPGMRYIVGGIVDKNRYKELCLKKAQKMGIPTRRLPIDEYINLEGRRVLTTTHVVQLMLKYFDDHNWKNAFESVLPPRKLDAEAKSASSSPAPKDT C3DC7C4BB2FFBE63 trna_gly_gcc tRNA_Gly_GCC trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCGCAAGUGGUUUAGUGGUAAAAUCCAACGUUGCCAUCGUUGGGCCCCCGGUUCGAUUCCGGGCUUGCGCA trna phe gaa trna Phe GAA trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCGGAUUUAGCUCAGUUGGGAGAGCGCCAGACUGAAGAUCUGGAGGUCCUGUGUUCGAUCCACAGAAUUCGCA trna cys gca trna Cys GCA trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCUCGUAUGGCGCAGUGGUAGCGCAGCAGAUUGCAAAUCUGUUGGUCCUUAGUUCGAUCCUGAGUGCGAGCU trna asn guu trna asn GUU trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GACUCCAUGGCCAAGUUGGUUAAGGCGUGCGACUGUUAAUCGCAAGAUCGUGAGUUCAACCCUCACUGGGGUCG tm10a_human tRNA methyltransferase 10 homolog A tRNA (guanine(9)-N(1))-methyltransferase TRMT10A TRMT10A RG9MTD2 RNA (guanine-9-)-methyltransferase domain-containing protein 2 protein protein human Homo sapiens Human MSSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKEKRKRKKLERQCQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFVKMNSRKVLAVNHVFEIILEYLETRDWQEAFFTILPQRKGAVPTDKACESASHDNQSVRMEEGGSDSDSSEEEYSRNELDSPHEEKQDKENHTESTVNSLPH 1FCDA258DD7CA04D trna val uac trna Val UAC trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GGUCCAAUGGUCCAGUGGUUCAAGACGUCGCCUUUACACGGCGAAGAUCCCGAGUUCGAACCUCGGUUGGAUCA trm10-trnaglygcc-2 1 4 enzyme target enzyme target substrate substrate neutral component neutral component N1 Methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 1A, Supp fig 1 trm10-trna val uac-1 1 9 enzyme target enzyme target substrate substrate neutral component neutral component N1 methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 1A, supp fig 1 trmt10a-trnaglygcc-1 1 4 enzyme target enzyme target substrate substrate neutral component neutral component N1 Methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain 8 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 1B, Supp fig 1 trmt10a-trna val uac-1 1 8 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) 9 enzyme target enzyme target substrate substrate neutral component neutral component N1 methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain methylation methylation reaction methylation Fig 1B, Supp fig 1 trm10-trna val uac-3 2 9 enzyme target enzyme target substrate substrate neutral component neutral component N1 methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 3 trm10-trnaglygcc-3 2 4 enzyme target enzyme target substrate substrate neutral component neutral component N1 Methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm yeast Saccharomyces cerevisiae Baker's yeast 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 3 trm10-trna cys gca-1 2 6 enzyme target enzyme target substrate substrate neutral component neutral component N1 Methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm yeast Saccharomyces cerevisiae Baker's yeast 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 3 trm10-trnaglygcc-4 1 4 enzyme target enzyme target substrate substrate neutral component neutral component N1 Methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 5 trm10-trna cys gca-2 1 6 enzyme target enzyme target substrate substrate neutral component neutral component N1 Methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 5 trm10-trna phe gaa-1 1 5 enzyme target enzyme target substrate substrate neutral component neutral component a9g mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain A G N1 Methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 5 trm10-trna asn guu-1 1 7 enzyme target enzyme target substrate substrate neutral component neutral component label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined N1 Methyl G rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 5