IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Cancer research 2012 imex curation Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar 20-Dec-2016: Contacted by IntAct-Help. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". Transplanted MPA-treated C4-HD tumors. There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Accepted 2016-DEC-01 AT 15:36 GMT AT 15:36 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Cancer research 2012 imex curation Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar 20-Dec-2016: Contacted by IntAct-Help. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Only protein-protein interactions human-breast_cancer Homo sapiens breast cancer tissue breast_cancer Breast cancer tissue confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". PR+/ER+ Invasive ductal carcinoma cells There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Accepted 2016-DEC-01 AT 15:36 GMT AT 15:36 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Cancer research 2012 imex curation Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar 20-Dec-2016: Contacted by IntAct-Help. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Only protein-protein interactions mouse-c4hd Mouse C4HD - ER+and PR+ progestin (MPA) induced mammary adenocarcinoma cell line c4hd C4HD Mouse ER+and PR+ progestin (MPA) induced mammary adenocarcinoma cell line confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Accepted 2016-DEC-01 AT 15:36 GMT AT 15:36 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Cancer research 2012 imex curation Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar 20-Dec-2016: Contacted by IntAct-Help. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Only protein-protein interactions human-breast_cancer Homo sapiens breast cancer tissue breast_cancer Breast cancer tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". PR+/ER+ Invasive ductal carcinoma cells There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Accepted 2016-DEC-01 AT 15:36 GMT AT 15:36 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Cancer research 2012 imex curation Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar 20-Dec-2016: Contacted by IntAct-Help. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Only protein-protein interactions human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". ChIP-re-ChIP. There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Accepted 2016-DEC-01 AT 15:36 GMT AT 15:36 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Cancer research 2012 imex curation Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar 20-Dec-2016: Contacted by IntAct-Help. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Only protein-protein interactions human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Accepted 2016-DEC-01 AT 15:36 GMT AT 15:36 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Cancer research 2012 imex curation Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar 20-Dec-2016: Contacted by IntAct-Help. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Only protein-protein interactions mouse Mus musculus Mouse confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". Transplanted MPA-treated C4-HD tumors. There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Accepted 2016-DEC-01 AT 15:36 GMT AT 15:36 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Cancer research 2012 imex curation Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar 20-Dec-2016: Contacted by IntAct-Help. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Only protein-protein interactions human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". PR+/ER+ Invasive ductal carcinoma cells There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Accepted 2016-DEC-01 AT 15:36 GMT AT 15:36 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Estrogen receptor alpha mediates progestin-induced mammary tumor growth by interacting with progesterone receptors at the cyclin D1/MYC promoters. Cancer research 2012 imex curation Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar 20-Dec-2016: Contacted by IntAct-Help. Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Only protein-protein interactions human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Supplementary data can be found under "Figures and Data". PR+/ER+ Invasive ductal carcinoma cells There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Accepted 2016-DEC-01 AT 15:36 GMT AT 15:36 GMT by ORCHARD Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation prgr_mouse Progesterone receptor Pgr Nr3c3 Pr Nuclear receptor subfamily 3 group C member 3 protein protein mouse Mus musculus Mouse MTELQAKDPQVLHTSGASPSPPHIGSPLLARLDSGPFQGSQHSDVSSVVSPIPISLDGLLFPRSCRGPELPDGKTGDQQSLSDVEGAFSGVEATHREGGRNSRAPEKDSRLLDSVLDSLLTPSGTEQSHASPPACEAITSWCLFGPELPEDPRSVPATKGLLSPLMSRPEIKAGDSSGTGAGQKVLPKGLSPPRQLLLPTSGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGSGGGVAANAASAAPGGVTLVPKEDSRFSAPRVSLEQDSPIAPGRSPLATTVVDFIHVPILPLNHALLAARTRQLLEGDSYDGGATAQGPFAPPRGSPSAPSPPVPCGDFPDCTYPLEGDPKEDVFPLYGDFQTPGLKIKEEEEGADAAVRSPRPYLSAGASSSTFPDFPLAPAPQRAPSSRPGEAAVAGGPSSAAVSPASSSGSALECILYKAEGAPPTQGSFAPLPCKPPAAGSCLLPRDSLPAAPATAAAPAIYQPLGLNGLPQLGYQAAVLKDSLPQVYPPYLNYLRPDSEASQSPQYGFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRTLDGVALPQSVGLPNESQALGQRITFSPNQEIQLVPPLINLLMSIEPDVVYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKELSFYSLCLTMWQIPQEFVKLQVTHEEFLCMKVLLLLNTIPLEGLRSQSQFEEMRSSYIRELIKAIGLRQKGVVPSSQRFYQLTKLLDSLHDLVKQLHLYCLNTFIQSRTLAVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK E26DDDE9529996A7 prgr_human Progesterone receptor PGR NR3C3 Nuclear receptor subfamily 3 group C member 3 protein protein human Homo sapiens Human MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLGPPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK DIP protein P06401 original sequence version: 196 DIP protein P06401-1 original sequence version: 186 DIP protein P06401-1 original sequence version: 192 80452E54FF3A0454 esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV DIP protein P03372 original sequence version: 214 DIP protein P03372 original sequence version: 139 DIP protein P03372 original sequence version: 167 5455C57AB0CCCAA7 myc_human_gene Human c-myc gene gene gene human Homo sapiens Human esr1_mouse Estrogen receptor Esr1 Esr Estr Estra Nr3a1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein mouse Mus musculus Mouse MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI 05F5E2FC21CC0A8B ccnd1_human_gene Human Cyclin D1 gene gene gene human Homo sapiens Human esr1-pgr-2 7 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 2D esr1-pgr-4 3 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 2 MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). ICI 182.780 - an estrogen receptor antagonist esr1-pgr-5 3 14 unspecified role unspecified role neutral component neutral component possible_phosphoser122 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 10 unspecified role unspecified role neutral component neutral component possible_phosphoser163 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm possible_phosphoser294 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm colocalization colocalization 2C MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). esr1-pgr-3 1 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 2D esr1-pgr-6 1 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 2Di esr1-pgr-7 2 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component possible_phosphoser162 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm possible_phosphoser190 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm colocalization colocalization 3A esr1-pgr-8 4 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 3C Two isoforms of PR were detected, but their identity cannot be confirmed. esr1-pgr-9 4 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 3Ci Two isoforms of PR were detected, but their identity cannot be confirmed. esr1-pgr-10 9 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component possible_phosphoser162 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm possible_phosphoser294 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm colocalization colocalization 4A, Supp 3 MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). MPA increased the nuclear colocalization between ERa and PR during the first 5 to 10 minutes and then a decrease was observed after 30 minutes of treatment. esr1-pgr-11 8 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait possible_phosphoser294 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm physical association physical association 4B MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). Two isoforms of PR were detected, but their identity cannot be confirmed. pgr-esr1-1 8 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey possible_phosphoser294 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm physical association physical association 4Bi MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). Two isoforms of PR were detected, but their identity cannot be confirmed. pgr-ccnd1_human_gene-1 6 11 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey promoter_progesterone_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C,7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). CHEBI:6716 increases the binding of P06401 to ENSG00000110092 CHEMBL1358 causes no change to the CHEBI:6716 stimulated binding of P06401 to ENSG00000110092 P03372 is not required for the binding of P06401 to ENSG00000110092 esr1-ccnd1_human_gene-1 6 12 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey promoter_oestrogen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C, 7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). CHEBI:6716 increases the binding of P03372 to ENSG00000110092 CHEBI:6716 increases expression at RNA level of ENSG00000110092 CHEBI:6716 increases expression at protein level of ENSG00000110092 CHEMBL1358 decreases expression at RNA level of ENSG00000110092 ICI 182,780 (CHEMBL1358) P03372 is required for the CHEBI:6716 induced increase in expression at RNA level of ENSG00000110092 P03372 is not required for the CHEBI:6716 induced increase in binding of P06401 to ENSG00000110092 CHEMBL1358 decreases the CHEBI:6716 stimulated binding of P03372 to ENSG00000110092 CHEMBL1358 decreases expression at protein level of P03372 pgr-myc_human_gene-1 6 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter_progesterone_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C,7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). CHEBI:6716 increases the binding of P06401 to ENSG00000136997 CHEMBL1358 causes no change to the CHEBI:6716 stimulated binding of P06401 to ENSG00000136997 P03372 is not required for the binding of P06401 to ENSG00000136997 esr1-myc_human_gene-1 6 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter_oestrogen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C,7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). CHEBI:6716 increases the binding of P03372 to ENSG00000136997 CHEBI:6716 increases expression at RNA level of ENSG00000136997 CHEBI:6716 increases expression at protein level of ENSG00000136997 CHEMBL1358 decreases expression at RNA level of ENSG00000136997 ICI 182,780 (CHEMBL1358) P03372 is required for the CHEBI:6716 induced increase in expression at RNA level of ENSG00000136997 P03372 is not required for the CHEBI:6716 induced increase in binding of P06401 to ENSG00000136997 CHEMBL1358 decreases the CHEBI:6716 stimulated binding of P03372 to ENSG00000136997 pgr-ccnd1_human_gene-2 5 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey promoter_progesterone_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C-5 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). esr1-myc_human_gene-2 5 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter_oestrogen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C-7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). esr1-ccnd1_human_gene-3 5 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey promoter_oestrogen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C-6 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). esr1-myc_human_gene-3 5 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey promoter_progesterone_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C-8 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone).