IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Long pentraxin 3/tumor necrosis factor-stimulated gene-6 interaction: a biological rheostat for fibroblast growth factor 2-mediated angiogenesis. Long pentraxin 3/tumor necrosis factor-stimulated gene-6 interaction: a biological rheostat for fibroblast growth factor 2-mediated angiogenesis. Arteriosclerosis, thrombosis, and vascular biology 2012 imex curation Leali D., Inforzato A., Ronca R., Bianchi R., Belleri M., Coltrini D., Di Salle E., Sironi M., Norata GD., Bottazzi B., Garlanda C., Day AJ., Presta M. Dark space = 32? anthony.day@manchester.ac.uk,presta@med.unibs.it Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Leali D., Inforzato A., Ronca R., Bianchi R., Belleri M., Coltrini D., Di Salle E., Sironi M., Norata GD., Bottazzi B., Garlanda C., Day AJ., Presta M. I cannot find any expression system for biotinylated PTX3 - "produced by standard techniques" is the best I can find, which is not adequate for our purposes. Dark space = 32? anthony.day@manchester.ac.uk,presta@med.unibs.it Accepted 2016-JUN-29 AT 07:58 BST AT 07:58 BST by ORCHARD Arteriosclerosis, thrombosis, and vascular biology 2012 Only protein-protein interactions imex curation imex curation Long pentraxin 3/tumor necrosis factor-stimulated gene-6 interaction: a biological rheostat for fibroblast growth factor 2-mediated angiogenesis. Long pentraxin 3/tumor necrosis factor-stimulated gene-6 interaction: a biological rheostat for fibroblast growth factor 2-mediated angiogenesis. Arteriosclerosis, thrombosis, and vascular biology 2012 imex curation Leali D., Inforzato A., Ronca R., Bianchi R., Belleri M., Coltrini D., Di Salle E., Sironi M., Norata GD., Bottazzi B., Garlanda C., Day AJ., Presta M. Dark space = 32? anthony.day@manchester.ac.uk,presta@med.unibs.it Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Leali D., Inforzato A., Ronca R., Bianchi R., Belleri M., Coltrini D., Di Salle E., Sironi M., Norata GD., Bottazzi B., Garlanda C., Day AJ., Presta M. Dark space = 32? anthony.day@manchester.ac.uk,presta@med.unibs.it Accepted 2016-JUN-29 AT 07:58 BST AT 07:58 BST by ORCHARD Arteriosclerosis, thrombosis, and vascular biology 2012 Only protein-protein interactions imex curation imex curation Long pentraxin 3/tumor necrosis factor-stimulated gene-6 interaction: a biological rheostat for fibroblast growth factor 2-mediated angiogenesis. Long pentraxin 3/tumor necrosis factor-stimulated gene-6 interaction: a biological rheostat for fibroblast growth factor 2-mediated angiogenesis. Arteriosclerosis, thrombosis, and vascular biology 2012 imex curation Leali D., Inforzato A., Ronca R., Bianchi R., Belleri M., Coltrini D., Di Salle E., Sironi M., Norata GD., Bottazzi B., Garlanda C., Day AJ., Presta M. Dark space = 32? anthony.day@manchester.ac.uk,presta@med.unibs.it Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Leali D., Inforzato A., Ronca R., Bianchi R., Belleri M., Coltrini D., Di Salle E., Sironi M., Norata GD., Bottazzi B., Garlanda C., Day AJ., Presta M. Cross-linking agent is BS -Bis[sulfosuccinimidyl]suberate Dark space = 32? anthony.day@manchester.ac.uk,presta@med.unibs.it Accepted 2016-JUN-29 AT 07:58 BST AT 07:58 BST by ORCHARD Arteriosclerosis, thrombosis, and vascular biology 2012 Only protein-protein interactions imex curation imex curation Long pentraxin 3/tumor necrosis factor-stimulated gene-6 interaction: a biological rheostat for fibroblast growth factor 2-mediated angiogenesis. Long pentraxin 3/tumor necrosis factor-stimulated gene-6 interaction: a biological rheostat for fibroblast growth factor 2-mediated angiogenesis. Arteriosclerosis, thrombosis, and vascular biology 2012 imex curation Leali D., Inforzato A., Ronca R., Bianchi R., Belleri M., Coltrini D., Di Salle E., Sironi M., Norata GD., Bottazzi B., Garlanda C., Day AJ., Presta M. Dark space = 32? anthony.day@manchester.ac.uk,presta@med.unibs.it Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Leali D., Inforzato A., Ronca R., Bianchi R., Belleri M., Coltrini D., Di Salle E., Sironi M., Norata GD., Bottazzi B., Garlanda C., Day AJ., Presta M. Dark space = 32? The expression system for the PTX3 N terminal construct has been taken from Ref 13; HEK-293F cells -also with C-terminal His/V5 tag. anthony.day@manchester.ac.uk,presta@med.unibs.it Accepted 2016-JUN-29 AT 07:58 BST AT 07:58 BST by ORCHARD Arteriosclerosis, thrombosis, and vascular biology 2012 Only protein-protein interactions imex curation imex curation ptx3_human Pentraxin-related protein PTX3 Pentaxin-related protein PTX3 TNFAIP5 TSG14 Tumor necrosis factor alpha-induced protein 5 Tumor necrosis factor-inducible gene 14 protein PTX3 protein protein human Homo sapiens Human MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS 09BCE02E2A62D62A tsg6_human Tumor necrosis factor-inducible gene 6 protein TSG6 TNFAIP6 Hyaluronate-binding protein TNF-stimulated gene 6 protein Tumor necrosis factor alpha-induced protein 6 protein protein human Homo sapiens Human MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL E2B3AEB76353A782 fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS DIP protein P09038 original sequence version: 169 DIP protein P09038 original sequence version: 129 EAE98552A39D5E19 23424-1 4 5 unspecified role unspecified role prey prey human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 6 unspecified role unspecified role bait bait c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction 1A tnfaip6-ptx3-1 4 5 unspecified role unspecified role prey prey human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 6 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1Ai tnfaip6-ptx3-4 2 5 unspecified role unspecified role bait bait human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 6 unspecified role unspecified role prey prey P98066:p.Tyr94Phe mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 19:23:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr94phe' Tue Jun 30 19:47:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr94Phe' c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P98066:p.Tyr47Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:36:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr47phe' Tue Jun 30 17:57:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr47Phe' P98066:p.Glu183Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E S Wed May 02 14:41:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu183ser' Tue Jun 30 18:19:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu183Ser' drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction 1B, Supp fig 1 dear checker:please look at the Kds on the mutants carefully as I was getting spurious entries and am not sure this has been fixed - as cannot see parameters in summary view tnfaip6-ptx3-5 2 5 unspecified role unspecified role bait bait human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 6 unspecified role unspecified role prey prey link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1Bi tnfaip6-ptx3-2 4 5 unspecified role unspecified role bait bait c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 6 unspecified role unspecified role prey prey c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction 2 tnfaip6-ptx3-3 4 5 unspecified role unspecified role bait bait human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 6 unspecified role unspecified role prey prey c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction 2i tnfaip6-ptx3-6 4 5 unspecified role unspecified role bait bait human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 6 unspecified role unspecified role prey prey link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 2B ptx3-tnfaip6-1 4 5 unspecified role unspecified role bait bait c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 6 unspecified role unspecified role prey prey link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 50 52 direct interaction direct interaction 2B 245w345-1 1 5 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A-1 fgf2-ptx3-1 1 5 competitor competitor competitor prey prey human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 5 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A-2 fgf2-ptx3-2 1 6 competitor competitor competitor prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 5 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A-3 fgf2-ptx3-3 4 6 competitor competitor competitor prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B fgf2-ptx3-4 3 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Supp fig 2 fgf2-ptx3-6 3 6 competitor competitor competitor neutral component neutral component drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 5 unspecified role unspecified role neutral component neutral component human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association 3A-3 fgf2-ptx3-5 4 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 3Bi