IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. The Journal of general virology 2012 imex curation Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Accepted 2017-FEB-27 AT 10:22 GMT AT 10:22 GMT by ORCHARD The Journal of general virology 2012 imex curation Altered; altered as before; I have removed the Sufficient to bind region. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. The Journal of general virology 2012 imex curation Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Accepted 2017-FEB-27 AT 10:22 GMT AT 10:22 GMT by ORCHARD The Journal of general virology 2012 imex curation Altered; altered as before; I have removed the Sufficient to bind region. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. The Journal of general virology 2012 imex curation Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins Fig 5A: I have added Viperin-HA with Biological role as "inhibitor" - it is hard to see if any NS5A is detected at all in RHS Lane 4, and if any HA-Viperin is present in LHS image Lane4. Fig 6A-RHS: I am not sure if I am seeing clearly here - there appears to be very little NS5B precipitated regardless of the presence of Viperin (see comment for figures) - but the Ig-Heavy chains band appears to be much bigger - maybe this is meant to be NS5B - but in control this runs at the top?? dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Accepted 2017-FEB-27 AT 10:22 GMT AT 10:22 GMT by ORCHARD The Journal of general virology 2012 imex curation Altered; altered as before; I have removed the Sufficient to bind region. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. The Journal of general virology 2012 imex curation Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Accepted 2017-FEB-27 AT 10:22 GMT AT 10:22 GMT by ORCHARD The Journal of general virology 2012 imex curation Altered; altered as before; I have removed the Sufficient to bind region. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33. The Journal of general virology 2012 imex curation Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins dark space = no 55? Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn Accepted 2017-FEB-27 AT 10:22 GMT AT 10:22 GMT by ORCHARD The Journal of general virology 2012 imex curation Altered; altered as before; I have removed the Sufficient to bind region. rsad2_human Radical S-adenosyl methionine domain-containing protein 2 RSAD2 CIG5 Cytomegalovirus-induced gene 5 protein Viperin Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible protein protein human Homo sapiens Human MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW ED014743CE1568DF q9wmx2-pro_0000037551 Non-structural protein 5A protein protein hcvco Hepatitis C virus genotype 1b (isolate Con1) (HCV) SGSWLRDVWDWICTVLTDFKTWLQSKLLPRLPGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFLVGLNQYLVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRLARGSPPSLASSSASQLSAPSLKATCTTRHDSPDADLIEANLLWRQEMGGNITRVESENKVVILDSFEPLQAEEDEREVSVPAEILRRSRKFPRAMPIWARPDYNPPLLESWKDPDYVPPVVHGCPLPPAKAPPIPPPRRKRTVVLSESTVSSALAELATKTFGSSESSAVDSGTATASPDQPSDDGDAGSDVESYSSMPPLEGEPGDPDLSDGSWSTVSEEASEDVVCC 1973 2419 AC8324B2DE0F7FAE q9wmx2-pro_0000037552 RNA-directed RNA polymerase protein protein hcvco Hepatitis C virus genotype 1b (isolate Con1) (HCV) SMSYTWTGALITPCAAEETKLPINALSNSLLRHHNLVYATTSRSASLRQKKVTFDRLQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSARSKFGYGAKDVRNLSSKAVNHIRSVWKDLLEDTETPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPGQRVEFLVNAWKAKKCPMGFAYDTRCFDSTVTENDIRVEESIYQCCDLAPEARQAIRSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKAAAACRAAKLQDCTMLVCGDDLVVICESAGTQEDEASLRAFTEAMTRYSAPPGDPPKPEYDLELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLDLPQIIQRLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRVWRHRARSVRARLLSQGGRAATCGKYLFNWAVRTKLKLTPIPAASQLDLSSWFVAGYSGGDIYHSLSRARPRWFMWCLLLLSVGVGIYLLPNR 2420 3010 AFAC9360E053D155 vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL DIP protein Q9P0L0 original sequence version: 136 DIP protein Q9P0L0 original sequence version: 130 68B603F3A9FA5475 45twt-1 3 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2A, 3B rsad2-vapa-2 1 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2B rsad2-vapa-3 5 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization 2C, 3C rsad2-vapa-4 3 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3E rsad2-vapa-5 5 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 3E vapa-rsad2-1 3 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 17:19:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Wed May 02 18:05:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 16:28:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5A vapa-q9wmx2_pro_0000037551-1 3 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 16:04:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 20:15:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5A-RHS vapa-q9wmx2_pro_0000037551-2 3 6 inhibitor inhibitor prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 19:23:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 15:46:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Ai In the presence of viperin, the level of immunoprecipitated myc–NS5A was markedly reduced. q9wmx2_pro_0000037551-vapa-1 3 6 inhibitor inhibitor prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 14:40:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 19:45:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5A-RHS The level of immunoprecipitated FLAG–hVAP-33 in cells transfected with HA–viperin was greatly reduced. vapa-q9wmx2_pro_0000037551-3 2 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 19:05:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 15:44:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C vapa-q9wmx2_pro_0000037551-4 2 6 inhibitor inhibitor prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 15:22:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 17:12:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Ci In the presence of viperin, the level of immunoprecipitated myc–NS5A was markedly reduced. q9wmx2_pro_0000037551-rsad2-1 2 6 inhibitor inhibitor prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 19:06:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 19:05:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5C-RHS The level of immunoprecipitated FLAG–hVAP-33 in cells transfected with HA–viperin was greatly reduced. q9wmx2_pro_0000037551-vapa-2 2 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 17:15:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 19:25:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' physical association physical association 5C-RHS rsad2-vapa-6 4 7 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 18:06:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 20:21:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' 6 inhibitor inhibitor neutral component neutral component 9 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 5D I suppose strictly speaking that Viperin should be an "antagonist" - but as it has been detected in IPs I felt safe to add Biological role as Inhibitor. q9wmx2_pro_0000037551-rsad2-2 5 7 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain S I Wed May 02 15:18:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ile' Tue Jun 30 17:52:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ile' 6 inhibitor inhibitor neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 5E I suppose strictly speaking that Viperin should be an "antagonist" - but as it has been detected in IPs I felt safe to add Biological role as Inhibitor. q9wmx2_pro_0000037551-rsad2-3 3 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6A-LHS q9wmx2_pro_0000037551-vapa-3 3 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6A-LHS vapa-q9wmx2_pro_0000037551-5 3 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6A RHS Very little myc-NS5B appears to have been precipitated (lanes 3 and 4). vapa-q9wmx2_pro_0000037551-6 3 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6A -RHS Very little myc-NS5B appears to have been precipitated (lanes 3 and 4).