IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular basis for LLT1 protein recognition by human CD161 protein (NKRP1A/KLRB1). Molecular basis for LLT1 protein recognition by human CD161 protein (NKRP1A/KLRB1). The Journal of biological chemistry 2011 imex curation Kamishikiryo J., Fukuhara H., Okabe Y., Kuroki K., Maenaka K. Dark Space no 64? maenaka@pharm.hokudai.ac.jp Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kamishikiryo J., Fukuhara H., Okabe Y., Kuroki K., Maenaka K. in Exp Proc for Biotin lygase rec. sequence it says it was inserted between signal sequence and Gly 90 - so I would think the biotin tag would be N-terminal, but the text clearly says "C-terminal" under Fig 2 - so have left as ?-? Dark Space no 64? maenaka@pharm.hokudai.ac.jp Accepted 2017-FEB-20 AT 12:16 GMT AT 12:16 GMT by ORCHARD The Journal of biological chemistry 2011 imex curation klrb1_human Killer cell lectin-like receptor subfamily B member 1 CLEC5B NKRP1A C-type lectin domain family 5 member B HNKR-P1a Natural killer cell surface protein P1A KLRB1 protein protein human Homo sapiens Human MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSVSVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS 01BFA925445B83B0 q9uhp7-1 C-type lectin domain family 2 member D CLEC2D CLAX LLT1 OCIL Lectin-like NK cell receptor Lectin-like transcript 1 Osteoclast inhibitory lectin protein protein human Homo sapiens Human MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV E71F3E21DC361F10 klrb1-clec2d-2 1 3 unspecified role unspecified role prey prey Q9UHP7-1:p.His176Cys mutation mutation certain certain sequence position certain certain certain sequence position certain H C Wed May 02 18:17:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his176cys' Tue Jun 30 17:37:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His176Cys' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UHP7-1:p.Cys163Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:38:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys163ser' Tue Jun 30 18:07:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys163Ser' Q9UHP7-1:p.Lys169Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Wed May 02 14:39:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys169glu' Tue Jun 30 16:16:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys169Glu' Q9UHP7-1:p.Arg175Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 18:26:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg175glu' Tue Jun 30 18:05:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg175Glu' Q9UHP7-1:p.Arg180Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 17:24:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg180glu' Tue Jun 30 16:47:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg180Glu' Q9UHP7-1:p.Lys181Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Wed May 02 18:30:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys181glu' Tue Jun 30 16:45:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys181Glu' Q9UHP7-1:p.Tyr165Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:35:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr165ala' Tue Jun 30 16:56:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr165Ala' Q9UHP7-1:p.Asn167Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A Wed May 02 18:09:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn167ala' Tue Jun 30 19:11:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn167Ala' ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q12918:p.Lys185Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:35:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys185ala' Tue Jun 30 18:05:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys185Ala' Q12918:p.Glu186Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E R Wed May 02 14:39:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu186arg' Tue Jun 30 17:06:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu186Arg' Q12918:p.Tyr198Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:23:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr198ala' Tue Jun 30 16:19:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr198Ala' Q12918:p.Glu200Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E R Wed May 02 18:37:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu200arg' Tue Jun 30 19:41:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu200Arg' Q12918:p.Glu200Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E A Wed May 02 20:26:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu200ala' Tue Jun 30 20:19:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu200Ala' Q12918:p.Tyr201Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:23:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr201ala' Tue Jun 30 17:46:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr201Ala' Q12918:p.Glu205Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E R Wed May 02 15:03:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu205arg' Tue Jun 30 15:57:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu205Arg' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12918:p.Glu162Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E R Wed May 02 16:23:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu162arg' Tue Jun 30 16:06:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu162Arg' Q12918:p.Glu179Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E R Wed May 02 17:12:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu179arg' Tue Jun 30 17:37:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu179Arg' Q12918:p.Glu179Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Wed May 02 18:55:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu179ala' Tue Jun 30 17:53:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu179Ala' Q12918:p.Arg181Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 20:08:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg181glu' Tue Jun 30 19:40:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg181Glu' Q12918:p.Asp183Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D R Wed May 02 17:07:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp183arg' Tue Jun 30 16:41:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp183Arg' Q12918:p.Lys185Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:50:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys185glu' Tue Jun 30 19:09:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys185Glu' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 24 7 direct interaction direct interaction 1B-D, 3B, Supp fig 2. Thermodynamic Parameter for H176C mutant: Delta G (Free energy) = -6kcal/mol I have not added more thermodynamic parameters as the Delta G is the important one, and is derived from the other values. klrb1-clec2d-1 1 2 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q12918:p.Glu205Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain E R Wed May 02 16:54:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu205arg' Tue Jun 30 17:36:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu205Arg' 3 unspecified role unspecified role prey prey ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UHP7-1:p.Lys169Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:42:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys169glu' Tue Jun 30 16:38:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys169Glu' 33 37 direct interaction direct interaction Figure 4A, Table 2 Almost all of the LLT1 mutants were unable to bind to the CD161 mutants. I have not entered any more of the mutant + mutant interactions as it would take too long.(and is of dubious utility?)