IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ On the existence of a possible A2A-D2-β-Arrestin2 complex: A2A agonist modulation of D2 agonist-induced β-arrestin2 recruitment. On the existence of a possible A2A-D2-β-Arrestin2 complex: A2A agonist modulation of D2 agonist-induced β-arrestin2 recruitment. Journal of molecular biology 2011 imex curation Borroto-Escuela DO., Romero-Fernandez W., Tarakanov AO., Ciruela F., Agnati LF., Fuxe K., Borroto-Escuela DO., Romero-Fernandez W., Tarakanov AO., Ciruela F., Agnati LF., Fuxe K. Dark space? 43 (Sandra asked for this) The isoform "D2LR" has been determined to be P14416-1 from Ciruela et al., 2004, pmid:15362892. (" D2LR, which was the isoform of the D2R used in the present experiments (pull-down and BRET), contains 29 additional amino acid residues".) fciruela@ub.edu,dasiel.borroto-escuela@ki.se,wilber.romero.fernandez@ki.se,tar@iias.spb.su,luigiagnati@tin.it,kjell.fuxe@ki.se 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Borroto-Escuela DO., Romero-Fernandez W., Tarakanov AO., Ciruela F., Agnati LF., Fuxe K., Borroto-Escuela DO., Romero-Fernandez W., Tarakanov AO., Ciruela F., Agnati LF., Fuxe K. Dark space? 43 (Sandra asked for this) The isoform "D2LR" has been determined to be P14416-1 from Ciruela et al., 2004, pmid:15362892. (" D2LR, which was the isoform of the D2R used in the present experiments (pull-down and BRET), contains 29 additional amino acid residues".) fciruela@ub.edu,dasiel.borroto-escuela@ki.se,wilber.romero.fernandez@ki.se,tar@iias.spb.su,luigiagnati@tin.it,kjell.fuxe@ki.se Accepted 2016-AUG-02 AT 10:59 BST AT 10:59 BST by ORCHARD Journal of molecular biology 2011 imex curation On the existence of a possible A2A-D2-β-Arrestin2 complex: A2A agonist modulation of D2 agonist-induced β-arrestin2 recruitment. On the existence of a possible A2A-D2-β-Arrestin2 complex: A2A agonist modulation of D2 agonist-induced β-arrestin2 recruitment. Journal of molecular biology 2011 imex curation Borroto-Escuela DO., Romero-Fernandez W., Tarakanov AO., Ciruela F., Agnati LF., Fuxe K., Borroto-Escuela DO., Romero-Fernandez W., Tarakanov AO., Ciruela F., Agnati LF., Fuxe K. Dark space? 43 (Sandra asked for this) The isoform "D2LR" has been determined to be P14416-1 from Ciruela et al., 2004, pmid:15362892. (" D2LR, which was the isoform of the D2R used in the present experiments (pull-down and BRET), contains 29 additional amino acid residues".) fciruela@ub.edu,dasiel.borroto-escuela@ki.se,wilber.romero.fernandez@ki.se,tar@iias.spb.su,luigiagnati@tin.it,kjell.fuxe@ki.se 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag visualisation tag visualisation Borroto-Escuela DO., Romero-Fernandez W., Tarakanov AO., Ciruela F., Agnati LF., Fuxe K., Borroto-Escuela DO., Romero-Fernandez W., Tarakanov AO., Ciruela F., Agnati LF., Fuxe K. Dark space? 43 (Sandra asked for this) The isoform "D2LR" has been determined to be P14416-1 from Ciruela et al., 2004, pmid:15362892. (" D2LR, which was the isoform of the D2R used in the present experiments (pull-down and BRET), contains 29 additional amino acid residues".) fciruela@ub.edu,dasiel.borroto-escuela@ki.se,wilber.romero.fernandez@ki.se,tar@iias.spb.su,luigiagnati@tin.it,kjell.fuxe@ki.se Accepted 2016-AUG-02 AT 10:59 BST AT 10:59 BST by ORCHARD Journal of molecular biology 2011 imex curation p14416-1 D(2) dopamine receptor Dopamine D2 receptor D2(Long) DRD2 D2A protein protein human Homo sapiens Human MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 9BF8EA36C988A2E2 arrb2_human Beta-arrestin-2 Arrestin beta-2 ARRB2 ARB2 ARR2 Non-visual arrestin-3 protein protein human Homo sapiens Human MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC DIP protein P32121 original sequence version: 148 DIP protein P32121 original sequence version: 102 DIP protein P32121-1 original sequence version: 86 DIP protein P32121-1 original sequence version: 100 DIP protein P32121 original sequence version: 153 DEEC507D4A7B84FF arrb2-drd2-1 1 3 unspecified role unspecified role neutral component neutral component c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 2 A2AR was co- transfected. Quinpirole; a D2R (and D3R) agonist (CHEBI:75401) CGS21680: an A2AR agonist (CHEBI:73283) arrb2-drd2-2 2 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role fluorescence donor fluorescence donor region luciferase tag luciferase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 3, 4 A2AR was co- transfected. Quinpirole; a D2R (and D3R) agonist (CHEBI:75401) Quinpirole AND CGS21680( an A2AR agonist) (CHEBI:73283)