UniProt UniProt http://www.uniprot.org MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. Molecular biology of the cell 2009 imex curation Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Accepted 2016-SEP-02 AT 14:53 BST AT 14:53 BST by ORCHARD Molecular biology of the cell 2009 imex curation MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. Molecular biology of the cell 2009 imex curation Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Accepted 2016-SEP-02 AT 14:53 BST AT 14:53 BST by ORCHARD Molecular biology of the cell 2009 imex curation MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. Molecular biology of the cell 2009 imex curation Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Accepted 2016-SEP-02 AT 14:53 BST AT 14:53 BST by ORCHARD Molecular biology of the cell 2009 imex curation MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. Molecular biology of the cell 2009 imex curation Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Accepted 2016-SEP-02 AT 14:53 BST AT 14:53 BST by ORCHARD Molecular biology of the cell 2009 imex curation MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. Molecular biology of the cell 2009 imex curation Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Accepted 2016-SEP-02 AT 14:53 BST AT 14:53 BST by ORCHARD Molecular biology of the cell 2009 imex curation MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling. Molecular biology of the cell 2009 imex curation Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Accepted 2016-SEP-02 AT 14:53 BST AT 14:53 BST by ORCHARD Molecular biology of the cell 2009 imex curation ehd3_human EH domain-containing protein 3 EHD3 EHD2 PAST3 PAST homolog 3 protein protein human Homo sapiens Human MFSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDMEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHGPFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADIDKDGMLDDDEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVAE 0F8AE99F84B966AD milk1_bovin MICAL-like protein 1 MICALL1 protein protein bovin Bos taurus (Bovine) Bovine MAGPRGALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFAGSGPAGVSSPRKGLVLSSPPSEASTPADPGDRAQGEECSSGSLSKQGSHRTPSSTCAACQQHVHLVQRYLADGKLYHRHCFRCRRCSSTLLPGAYRNGPEEGTFVCAEHCARLGPSGRSGARPGTPPQPKQQQLTEEAKEVEGGSPSPKATAGAEADVPKASPEGRPQVPTKPRVPGRPQELASPPASRPTPAPRKASESTAPTPPTPRPRSSLQQENLVEQGGGSGLVNGKLQEPPIPKPRGTPKLSERTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPPGQEGRQVENGGVDKAAPRGPEPKPYNPFEEEEEEPPAAPSPAPGPAPTPPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSTSPLTLHASRLSRSEPPSATPSPALSVESLSSESSSQAPSEELLEPPVVPKSSSEPAVHAPGTPGTSASLSANSSLSSSGELVQPSMDRTPQASPGLAPNSRGSPGPPPAKPCSGTAPTPLVLVGDKSPAPSPGTSSPQLQVKSSCKENPFNRKPSPTASPSVKKATKGSKPARPPAPGHGFPLIKRKVQSDQYIPEEDIHGEIDTIERQLDALEHRGVLLEEKLRGGVNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRGREKVLMQELVTLIEQRNAIVNCLDEDRQREEEEDKMLEAMIKKKEFQKETEPEGKKKGKFKTMKVLKLLGNKRDTKSKCPGDRS 8437D72B2161E7F4 ehd1_human EH domain-containing protein 1 Testilin CDABP0131 EHD1 PAST PAST1 PAST homolog 1 protein protein human Homo sapiens Human MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE 3330218772A26CE4 ehd4_human EH domain-containing protein 4 Hepatocellular carcinoma-associated protein 10/11 EHD4 HCA10 HCA11 FKSG7 PAST4 PAST homolog 4 protein protein human Homo sapiens Human MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD 72DDE551829B7BF5 milk1_human MICAL-like protein 1 MICALL1 KIAA1668 MIRAB13 Molecule interacting with Rab13 protein protein human Homo sapiens Human MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDVAQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVPKPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLESKPYNPFEEEEEDKEEEAPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLALHASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSLASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSCKENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS 755E3B57C6037292 rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL DIP protein P61006 original sequence version: 82 DIP protein P61006 original sequence version: 100 DIP protein P61006 original sequence version: 128 DIP protein P61006 original sequence version: 132 AA52DBF54A2CD056 ehd1-micall1-3 6 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey bovin-brain Bos taurus brain brain Brain [cerebrum] physical association physical association no figure ehd1-micall1-4 1 11 unspecified role unspecified role bait bait Q8N3F8:p.[Asn425Ala;Phe427Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain N A Wed May 02 18:40:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn425ala,phe427ala' Tue Jun 30 20:03:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn425Ala;Phe427Ala]' 9 unspecified role unspecified role prey prey physical association physical association 1B ehd1-micall1-5 3 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate Q8N3F8:p.[Asn425Ala;Phe427Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain N A Wed May 02 20:30:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn425ala,phe427ala' Tue Jun 30 16:16:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn425Ala;Phe427Ala]' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association 1C micall1-ehd1-2 4 11 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D ehd1-micall1-6 1 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association supplemental 1A ehd3-micall1-3 1 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association supplemental 1A ehd1-micall1-7 2 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined eh_domain sufficient to bind sufficient binding region sufficient to bind range range range range Q9H4M9:p.Lys483Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:32:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys483glu' Tue Jun 30 20:21:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys483Glu' ecoli Escherichia coli (strain K12) EHD1 mutant construct lys483glu also interacts 11 unspecified role unspecified role prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association 3 and supplemental 1B ehd3-micall1-4 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined eh_domain sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association supplemental 1B micall1-1 2 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined eh_domain sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association supplemental 1B micall1-ehd1-3 5 11 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2C ehd1-micall1-8 5 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 2F ehd1-micall1-9 2 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) EHD1 mutant construct lys483glu also interacts 11 stimulator stimulator prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 12 unspecified role unspecified role prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 association association 6K