UniProt UniProt http://www.uniprot.org Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Biochemical and biophysical research communications 2009 imex curation Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Accepted 2016-NOV-16 AT 10:38 GMT AT 10:38 GMT by MGT Biochemical and biophysical research communications 2009 imex curation Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Biochemical and biophysical research communications 2009 imex curation Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Accepted 2016-NOV-16 AT 10:38 GMT AT 10:38 GMT by MGT Biochemical and biophysical research communications 2009 imex curation Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Biochemical and biophysical research communications 2009 imex curation Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Accepted 2016-NOV-16 AT 10:38 GMT AT 10:38 GMT by MGT Biochemical and biophysical research communications 2009 imex curation Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Biochemical and biophysical research communications 2009 imex curation Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Accepted 2016-NOV-16 AT 10:38 GMT AT 10:38 GMT by MGT Biochemical and biophysical research communications 2009 imex curation Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Biochemical and biophysical research communications 2009 imex curation Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. Origin of Tal1 in Gal4-Tal1 construct according PMID 10527940 following Ref. 10 (PMID 14560005). Gal4-Eto2 and Mtgr1 plasmid ('...obtained from Joseph Amann..) have been described in PMID 11533236 and PMID 16227606, respectively. stephen.brandt@vanderbilt.edu Accepted 2016-NOV-16 AT 10:38 GMT AT 10:38 GMT by MGT Biochemical and biophysical research communications 2009 imex curation Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Biochemical and biophysical research communications 2009 imex curation Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Accepted 2016-NOV-16 AT 10:38 GMT AT 10:38 GMT by MGT Biochemical and biophysical research communications 2009 imex curation Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Eto2/MTG16 and MTGR1 are heteromeric corepressors of the TAL1/SCL transcription factor in murine erythroid progenitors. Biochemical and biophysical research communications 2009 imex curation Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-fva mouse splenic proerythrocytoblasts infected with Friend erythroleukemia virus Mouse fva splenic proerythrocytoblasts infected with Friend erythroleukemia virus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Accepted 2016-NOV-16 AT 10:38 GMT AT 10:38 GMT by MGT Biochemical and biophysical research communications 2009 imex curation mtg8r_mouse Protein CBFA2T2 Cbfa2t2 Cbfa2t2h MTG8-like protein MTG8-related protein 1 Mtgr1 protein protein mouse Mus musculus Mouse MVGVPGAAAFQLGCEKRVPAMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERDTVPPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREVRERHHNLSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPATGYVPVEFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAAEDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHGHSPHSQSRPLLPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL DIP protein O70374 original sequence version: 122 mint FCE4A6A0AFD66377 ldb1_mouse LIM domain-binding protein 1 Ldb1 Nli Carboxyl-terminal LIM domain-binding protein 2 LIM domain-binding factor CLIM2 Nuclear LIM interactor protein protein mouse Mus musculus Mouse MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ DIP protein P70662 original sequence version: 130 47C53DFA23044580 mtg16_mouse Protein CBFA2T3 Cbfa2t3 Cbfa2t3h Mtgr2 Protein ETO-2 Eight twenty one protein 2 MTG8-related protein 2 protein protein mouse Mus musculus Mouse MSQASTTTLESGALLSGPRGLQYGSPAHRKEKAAAMPDSPAEVKTQPRSTPPSMPPPPPTSSQGATRPPSFTPHTHGEDGPATSLPHGRFHGCLKWSMVCLLMNGSSHSPTAIHGAPSTPNGFSNGPATSSTASLSTQHLPPACGARQLSKLKRFLTTLQQFGSDISPEIGERVRTLVLGLVNSTLTIEEFHAKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQTPAQYLAQHEQLLLDASATSPVDSSELLLEVNENGKRRTPDRTKENGSDRDPLHPDHLSKRSCTLSPAQRCSPSNGLPHPTPPPPPHYRLEDMAMAHHFRDSYRHPDPRELRERHRPLAIPGSRQEEVIDHRLTEREWAEEWKHLNSLLNCIMDMVEKTRRSLTVLRRCQEADREELNHWIRCYSDSEEGKKGPTPISARSLNSCSGPEGSQLDVHRDFTPRTLSGYMPEEIWRKAEEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQASEDALTVINQQEDSSESCWNCGRKASETCSGCNAARYCGSFCQHKDWEKHHHVCGQSLQGPAAAVADPLPGQPDATASPSEAGSAGPSRPCSPGPPGPLDAAVPR mint Functions as a transcriptional repressor. Regulates the proliferation and the differentiation of erythroid progenitors by repressing the expression of TAL1 target genes. Plays a role in granulocyte differentiation. May also function as an A-kinase-anchoring protein 78DC1995BE365E43 gata1_mouse Erythroid transcription factor Gata1 Gf-1 Eryf1 GATA-binding factor 1 NF-E1 DNA-binding protein protein protein mouse Mus musculus Mouse MDFPGLGALGTSEPLPQFVDSALVSSPSDSTGFFSSGPEGLDAASSSTSPNAATAAASALAYYREAEAYRHSPVFQVYPLLNSMEGIPGGSPYASWAYGKTALYPASTVCPSHEDAPSQALEDQEGKSNNTFLDTLKTERLSPDLLTLGTALPASLPVTGSAYGGADFPSPFFSPTGSPLSSAAYSSPKFHGSLPLAPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRMIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSNLAGAGAAEGPAGGFMVVAGSSSSGNCGEVASGLALGTAGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTTSFPTGPAPTTSSTSVIAPLSS DIP protein P17679 original sequence version: 100 rbtn2_mouse Rhombotin-2 Lmo2 Rbtn-2 Rbtn2 Rhom-2 Cysteine-rich protein TTG-2 LIM domain only protein 2 T-cell translocation protein 2 protein protein mouse Mus musculus Mouse MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGII epb42_mouse_gene Erythrocyte membrane protein band 4.2 Epb42 Epb4.2 gene gene mouse Mus musculus Mouse tal1_mouse T-cell acute lymphocytic leukemia protein 1 homolog Tal1 Scl Tal-1 Stem cell protein protein protein mouse Mus musculus Mouse MTERPPSEAARSDPQLEGQDAAEARMAPPHLVLLNGVAKETSRAAPAEPPVIELGARSGAGGGPASGGGAARDLKGRDAVAAEARLRVPTTELCRPPGPAPAPAPASAPAELPGDGRMVQLSPPALAAPAGPGRALLYSLSQPLASLGSGFFGEPDAFPMFTNNNRVKRRPSPYEMEISDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKPGKDPVVGAGGGGAGGGIPPEDLLQDVLSPNSSCGSSLDGAASPDSYTEEPTPKHTSRSLHPALLPAADGAGPR DIP protein P22091 original sequence version: 93 mint Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation Involved in chromosomal translocation in leukemic stem-cells 189480B6B93CB371 glpa_mouse_gene Glycophorin-A Gypa gene gene mouse Mus musculus Mouse tal1-cbfa2t2-1 2 8 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1C and 2A DMSO (causing cell differentiation) tal1-cbfa2t2-2 5 8 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey physical association physical association 1B tal1-cbfa2t2-3 1 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association supplemental figure and text tal1-cbfa2t2-4 7 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 2B Erythropoetin (causing cell differentiation) tal1-cbfa2t2-5 6 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association 3A Greater amounts of Eto2 and Mtgr1 were precipitated in cells transduced with both proteins, rather than one. tal1-cbfa2t3-7 4 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 3B Tcf3/E47 tal1-cbfa2t2-7 4 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 3C Cbfa2t3/Eto2 tal1-cbfa2t2-6 5 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 14 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association 4A tal1-cbfa2t2-8 5 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association 4B 3465s4yerg-1 3 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4E DMSO cbfa2t3-epb42-1 3 10 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4Ei DMSO